(data stored in ACNUC7421 zone)

EMBL: CP001720.PE295

CP001720.PE295       Location/Qualifiers
FT   CDS_pept        323374..324123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0307"
FT                   /product="methionine aminopeptidase, type I"
FT                   /note="TIGRFAM: methionine aminopeptidase, type I; PFAM:
FT                   peptidase M24; KEGG: bha:BH0156 methionine aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61260"
FT                   /db_xref="GOA:C8W406"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR002467"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:C8W406"
FT                   /inference="protein motif:TFAM:TIGR00500"
FT                   /protein_id="ACV61260.1"
FT                   /translation="MITCKSERELMYMREAGKIAAEALAKLAGAVQPGVTTKELDRLAE
FT                   EYIRSCGARPAFKGLYGFPATICSSVNEEVVHGIPGLRKLENGDIISIDIGTEVNGYFG
FT                   DCAVTLAVGKVSDEAWRLIKVTEESFYAGIAKAKIGNRLSDISNAVQKYVEEHGFSVVR
FT                   DYVGHGIGSSMHEEPQVPNFGKPGRGPRLQAGMTLAIEPMVNMGTYEVRTLPDNWTVVT
FT                   KDRKLSSHYEHTIAITDNEPEILTRLK"
     atgattacat gcaaatccga aagggagtta atgtacatgc gggaggccgg taaaattgct        60
     gctgaagcac tggctaaatt agcaggtgcc gtgcagcccg gtgttactac aaaagaactc       120
     gaccggctgg cggaggagta tatcagaagc tgtggcgcaa gaccggcatt taaaggtcta       180
     tatgggttcc ctgctactat ctgttcgtct gtgaatgagg aagtggtgca tggtatccct       240
     ggtttaagaa agctggaaaa cggtgatatt ataagtatag acattggcac ggaggtaaac       300
     ggttattttg gggattgtgc ggttactttg gcggtaggca aggtgtccga tgaagcctgg       360
     cggctgatta aggttactga ggaatcattt tatgccggaa ttgccaaggc caaaatcggc       420
     aaccggctct ctgacatatc gaatgctgtt cagaaatatg tagaggaaca tggtttttca       480
     gttgttcgtg attatgtggg ccatggaata ggaagcagca tgcacgagga acctcaagta       540
     cctaacttcg gtaagccggg ccgggggccc aggttgcagg ctggcatgac attagcaata       600
     gaacctatgg taaatatggg tacttatgaa gtgcgtactt tacccgataa ttggacagta       660
     gttaccaagg accgtaaact gtcgtcacat tatgagcata ccatagctat tactgataat       720
     gagcctgaga tattaaccag gctcaaataa                                        750
//

If you have problems or comments...

PBIL Back to PBIL home page