(data stored in ACNUC7421 zone)

EMBL: CP001720.PE296

CP001720.PE296       Location/Qualifiers
FT   CDS_pept        324166..324447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0308"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bha:BH0157 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61261"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041985"
FT                   /db_xref="UniProtKB/TrEMBL:C8W407"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61261.1"
FT                   /translation="MSGKLKIGQLVQSVSGRDAGKYYLVWDVADTSRALLVDGLGRKAD
FT                   RPKKKNVKHLKAYPVIIDEIEKELLAGQRVSDLEVHKALEILIKNRTR"
     atgagtggta aactcaaaat cggccaatta gttcagtcag tatcaggccg ggatgcgggt        60
     aaatactact tggtttggga tgtggcagat acatccagag ccttattagt ggatggactg       120
     ggacgcaaag cagaccgtcc aaaaaagaaa aatgtgaaac acctaaaggc ataccctgtt       180
     attatagatg agatagaaaa agaacttctt gcgggccaaa gagtgtctga cttagaggtg       240
     cataaggctc tagagatctt aataaagaac cgaactcgat aa                          282
//

If you have problems or comments...

PBIL Back to PBIL home page