(data stored in ACNUC7421 zone)

EMBL: CP001720.PE297

CP001720.PE297       Location/Qualifiers
FT   CDS_pept        324497..324715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0309"
FT                   /product="translation initiation factor IF-1"
FT                   /note="KEGG: bha:BH0158 translation initiation factor IF-1;
FT                   TIGRFAM: translation initiation factor IF-1; PFAM: S1 IF1
FT                   family protein; SMART: RNA binding S1 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61262"
FT                   /db_xref="GOA:C8W408"
FT                   /db_xref="InterPro:IPR004368"
FT                   /db_xref="InterPro:IPR006196"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:C8W408"
FT                   /inference="protein motif:TFAM:TIGR00008"
FT                   /protein_id="ACV61262.1"
FT                   /translation="MSKQDVIEVEGKVIEPLPNAMFRVELDNGHKVLAHVSGKIRMNFI
FT                   RILAGDRVMVELSPYDLTRGRIIYRYK"
     atgtcaaagc aagatgtaat cgaagttgaa ggtaaagtta ttgagccgct gcccaatgca        60
     atgttccgag ttgaattaga taacggacat aaagtgctgg cacatgtatc tggaaaaata       120
     agaatgaatt ttatcagaat cctggcaggg gatagggtga tggttgagtt gtcaccatat       180
     gatcttacca gggggcggat tatctacagg tataaataa                              219
//

If you have problems or comments...

PBIL Back to PBIL home page