(data stored in ACNUC7421 zone)

EMBL: CP001720.PE298

CP001720.PE298       Location/Qualifiers
FT   CDS_pept        324746..324859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0310"
FT                   /product="ribosomal protein L36"
FT                   /note="TIGRFAM: ribosomal protein L36; PFAM: ribosomal
FT                   protein L36; KEGG: bsu:BSU01400 50S ribosomal protein L36"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61263"
FT                   /db_xref="GOA:C8W409"
FT                   /db_xref="InterPro:IPR000473"
FT                   /db_xref="InterPro:IPR035977"
FT                   /db_xref="UniProtKB/TrEMBL:C8W409"
FT                   /inference="protein motif:TFAM:TIGR01022"
FT                   /protein_id="ACV61263.1"
FT                   /translation="MKVRSSVKAICEKCKIIRRKGKVMVICDNPKHKQVQG"
     gtgaaagtaa gaagctcagt taaagccata tgcgaaaagt gtaagattat tcgtagaaaa        60
     ggcaaagtca tggttatatg tgacaacccc aaacacaagc aggttcaggg gtag             114
//

If you have problems or comments...

PBIL Back to PBIL home page