(data stored in ACNUC7421 zone)

EMBL: CP001720.PE3

CP001720.PE3         Location/Qualifiers
FT   CDS_pept        2713..2928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0003"
FT                   /product="RNA-binding S4 domain protein"
FT                   /note="PFAM: RNA-binding S4 domain protein; KEGG:
FT                   geo:Geob_1253 RNA-binding S4 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ACV60968"
FT                   /db_xref="GOA:C8VV99"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:C8VV99"
FT                   /inference="protein motif:PFAM:PF01479"
FT                   /protein_id="ACV60968.1"
FT                   /translation="MNKQIKVKGPIRLDQFLKWATIVSTGGQAKILITSGGVKVNQSIE
FT                   IKRGRNLKNGDIVQVGDILYHVNSTE"
     ctgaataagc agataaaagt taaaggccct atacgattag atcagttttt aaaatgggcc        60
     actattgttt ccactggtgg acaagctaag attcttataa cttcaggtgg tgtaaaggtt       120
     aatcaaagta tcgaaattaa aaggggaaga aatttgaaaa atggtgatat tgtacaagta       180
     ggagatattc tttaccatgt caatagtaca gaataa                                 216
//

If you have problems or comments...

PBIL Back to PBIL home page