(data stored in ACNUC7421 zone)

EMBL: CP001720.PE30

CP001720.PE30        Location/Qualifiers
FT   CDS_pept        33752..34114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0031"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dat:HRM2_15230 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ACV60995"
FT                   /db_xref="GOA:C8VVE4"
FT                   /db_xref="InterPro:IPR023878"
FT                   /db_xref="UniProtKB/TrEMBL:C8VVE4"
FT                   /inference="similar to AA sequence:KEGG:HRM2_15230"
FT                   /protein_id="ACV60995.1"
FT                   /translation="MSSKKNADITADIQNGMNSQKKRYYRKNVEFFKLLEKVKLWPSRS
FT                   GTLHGIKSIKIHSNTAEVTTFCGEMFIIWNSRNSRASRWLRNKWSFCACGKCKIPAWKI
FT                   EKYTTTMMTQKWGSGL"
     atgagttcga aaaaaaacgc cgatattacc gcggatatac aaaatggcat gaacagtcaa        60
     aagaaaagat attacagaaa aaatgttgag ttttttaagc tgctggaaaa ggttaagcta       120
     tggccatctc gttccggtac tttgcacggg attaaatcaa ttaaaattca tagcaatacc       180
     gctgaagtaa ctactttttg cggggaaatg tttattattt ggaattcgcg aaacagcagg       240
     gcctccaggt ggttgaggaa taagtggtcc ttttgtgcct gcggcaaatg taaaatacca       300
     gcctggaaga tagaaaaata tactactaca atgatgaccc aaaaatgggg ctccggtttg       360
     tag                                                                     363
//

If you have problems or comments...

PBIL Back to PBIL home page