(data stored in ACNUC7421 zone)

EMBL: CP001720.PE300

CP001720.PE300       Location/Qualifiers
FT   CDS_pept        325270..325659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0312"
FT                   /product="ribosomal protein S11"
FT                   /note="PFAM: ribosomal protein S11; KEGG: bha:BH0161 30S
FT                   ribosomal protein S11"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61265"
FT                   /db_xref="GOA:C8W411"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/TrEMBL:C8W411"
FT                   /inference="protein motif:PFAM:PF00411"
FT                   /protein_id="ACV61265.1"
FT                   /translation="MARRTVRTKRRERKNIEQGVAHIKSTFNNTIVTIADIKGNAISWA
FT                   SAGGVGFKGSRKSTPFAAQLAAETAAKAAMEHGLKEVEVMVKGPGAGREAAIRSLQAAG
FT                   LEVNLIKDVTPIPHNGCRPPKRRRV"
     gtggctcgac gcacagtaag aaccaaacgt cgtgaacgaa aaaatataga gcaaggtgtt        60
     gcccatatta agtcgacctt taataatact atcgtaacca tagccgatat taaaggaaat       120
     gctatttcat gggctagcgc gggtggcgtt ggttttaaag gttcccgtaa gagtacgcca       180
     tttgccgctc aacttgcagc tgaaacagca gctaaagctg ccatggaaca tggcttgaaa       240
     gaagttgaag taatggttaa gggccccgga gccggaagag aagcagctat tcgctcattg       300
     caggcagccg gtttagaagt aaaccttata aaagatgtta ctcctattcc gcataatggc       360
     tgtcgtccac cgaagcgccg gagagtctaa                                        390
//

If you have problems or comments...

PBIL Back to PBIL home page