(data stored in ACNUC7421 zone)

EMBL: CP001720.PE301

CP001720.PE301       Location/Qualifiers
FT   CDS_pept        325679..326305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0313"
FT                   /product="ribosomal protein S4"
FT                   /note="KEGG: gbm:Gbem_0959 ribosomal protein S4; TIGRFAM:
FT                   ribosomal protein S4; PFAM: ribosomal protein S4;
FT                   RNA-binding S4 domain protein; SMART: RNA-binding S4 domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61266"
FT                   /db_xref="GOA:C8W412"
FT                   /db_xref="InterPro:IPR001912"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005709"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:C8W412"
FT                   /inference="protein motif:TFAM:TIGR01017"
FT                   /protein_id="ACV61266.1"
FT                   /translation="MARYTGPQCKLCRREGLKLYLKGDRCYSDKCAIDRRSYPPGQHGQ
FT                   SRRKVSEYGTQLREKQKVRRIYGVLEKQFRTYFDRADRQQGITGENLLRLLERRMDNVI
FT                   FRMGLGASRVEARQLVTHGHFTVNGRKVDIPSFLVKVGDVIGIREGSKDSPRIKELMER
FT                   AAEKTRPAWLEYDSDAAQGRIVALPRRDEIDAPVQEHLIVELYSR"
     atggcaagat atacaggccc tcaatgtaaa ctttgtcgcc gtgaaggctt gaagttatat        60
     ttaaaaggtg accgttgtta ctctgacaag tgcgccattg atcggagaag ttatcctccc       120
     ggccaacacg ggcaatccag acgaaaagtg tctgagtacg gtacacagct cagagaaaaa       180
     caaaaagtgc gccgtatcta cggtgtgctg gagaagcaat tccgtaccta ttttgacaga       240
     gccgatcgcc agcagggtat taccggtgaa aacctgctcc ggcttttaga aagacgtatg       300
     gacaatgtaa tattccgtat gggtttaggt gcatcaagag tggaagcaag acagctggta       360
     actcacggtc actttactgt taacggcaga aaagttgata taccgtcatt cctggtaaaa       420
     gtcggcgatg taatcggcat tcgggaaggc agcaaagatt ctcccaggat aaaggaatta       480
     atggaacggg cagcagaaaa gacacgtccg gcatggctgg aatatgacag tgacgcggct       540
     cagggcagga ttgtagcatt gccgaggcgg gatgaaattg acgcaccggt tcaggaacac       600
     ctgattgtag aactctactc caggtaa                                           627
//

If you have problems or comments...

PBIL Back to PBIL home page