(data stored in ACNUC7421 zone)

EMBL: CP001720.PE302

CP001720.PE302       Location/Qualifiers
FT   CDS_pept        326359..327306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0314"
FT                   /product="DNA-directed RNA polymerase, alpha subunit"
FT                   /note="KEGG: bha:BH0162 DNA-directed RNA polymerase subunit
FT                   alpha; TIGRFAM: DNA-directed RNA polymerase, alpha subunit;
FT                   PFAM: RNA polymerase insert; RNA polymerase alpha subunit
FT                   domain protein; RNA polymerase dimerisation; SMART: RNA
FT                   polymerase RpoA/D/Rpb3-type"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61267"
FT                   /db_xref="GOA:C8W413"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/TrEMBL:C8W413"
FT                   /inference="protein motif:TFAM:TIGR02027"
FT                   /protein_id="ACV61267.1"
FT                   /translation="MQIEKPRIECVETNEDNTYGKFIVEPLERGYGITLGNSLRRILLS
FT                   SLPGVAVTSVKIDGVLHEFSTVPGVREDVTDIILNLKSLRLKMHGEADEKILRIEAQGE
FT                   GEVRAGDIVPDSDVEILNPDMYIATLAANGRLSMDITIARGRGYFSAERNKKGEPIIGV
FT                   IPIDSIFTPVYKVNYSVENTRVGQRTDYDKLSIEIWTDGSIHPDEAASLAAKIMSEHLQ
FT                   LFIGLTEETKDVEIMVEKEEEKKDKIMEMTIEELDLSVRSYNCLKRACINTVEELIQRN
FT                   EEDMMKVRNLGKKSLEEVIQKLNELGVSLKESEE"
     atgcaaattg agaaaccacg tattgagtgt gttgaaacaa atgaagacaa tacttacggt        60
     aaatttatcg ttgaaccgct ggagagggga tacggtatta cgctgggtaa ttccttacgg       120
     cgtatattgc tttcctcttt gccaggggtg gcggtaactt cggtaaaaat cgatggagtc       180
     ttacatgagt tttcaaccgt gccgggggtt agagaagacg ttaccgacat tatcctgaat       240
     ctgaaaagcc tgcgtttgaa aatgcatggc gaagctgatg aaaaaatctt acggatagaa       300
     gctcagggtg aaggtgaagt gagggccggt gacatagttc ctgacagtga cgtggaaata       360
     ttaaatccgg atatgtacat tgctaccctg gctgctaacg gtcgtctatc tatggatata       420
     actattgcga gaggtagggg ctatttttcg gctgaacgaa ataagaaggg tgagccgata       480
     ataggtgtta taccgataga ttctatcttt acacctgtct ataaagtaaa ttattcagtg       540
     gaaaatacac gtgtcggtca gcgtactgat tatgacaaac tttctattga gatatggaca       600
     gacggaagta ttcatcctga tgaagcagcc agtctggcag ctaaaattat gagtgaacat       660
     ctgcagttat ttataggact gactgaagaa accaaagatg ttgaaataat ggtggaaaaa       720
     gaagaagaga aaaaagataa gatcatggaa atgactattg aagaactcga tctttctgtt       780
     cgctcatata attgcctgaa gagagcatgt attaatacag tagaagaatt gattcaacgt       840
     aacgaagaag atatgatgaa agttagaaac ctgggtaaaa agtcattgga agaggttatt       900
     caaaaactca atgaactagg tgtgtccttg aaggaatctg aagagtaa                    948
//

If you have problems or comments...

PBIL Back to PBIL home page