(data stored in ACNUC7421 zone)

EMBL: CP001720.PE303

CP001720.PE303       Location/Qualifiers
FT   CDS_pept        327320..327658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0315"
FT                   /product="ribosomal protein L17"
FT                   /note="TIGRFAM: ribosomal protein L17; PFAM: ribosomal
FT                   protein L17; KEGG: pca:Pcar_0729 50S ribosomal protein L17"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61268"
FT                   /db_xref="GOA:C8W414"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/TrEMBL:C8W414"
FT                   /inference="protein motif:TFAM:TIGR00059"
FT                   /protein_id="ACV61268.1"
FT                   /translation="MGYRKLGLLSSHRRAMFRSLVTSLLDKEKITTTEARAKEIRRIAE
FT                   KLITLGKRGDLAARRQVLQYVWDEKVVGKLFDTIAPKYSERQGGYTRIIKLGARRGDAA
FT                   DMVILELV"
     atgggatacc gcaagttggg gttgctttcc agtcatagaa gagcaatgtt tcgtagtttg        60
     gtaacttcac ttttagataa agaaaaaatt acaactacag aggccagagc taaggaaatc       120
     aggcgtattg ctgagaagct gatcaccctg ggtaagcgcg gcgacctggc tgcccgccgg       180
     caggtattgc agtatgtttg ggacgaaaaa gtcgtaggta aactttttga cactattgct       240
     cctaaatatt ctgagaggca aggcggttat accagaataa ttaagctggg tgccagacgt       300
     ggtgacgcgg cagatatggt aatactggaa ctcgtataa                              339
//

If you have problems or comments...

PBIL Back to PBIL home page