(data stored in ACNUC7421 zone)

EMBL: CP001720.PE305

CP001720.PE305       Location/Qualifiers
FT   CDS_pept        328499..329350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0317"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bsu:BSU01460 cobalt transporter ATP-binding subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61270"
FT                   /db_xref="GOA:C8W416"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030946"
FT                   /db_xref="UniProtKB/TrEMBL:C8W416"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACV61270.1"
FT                   /translation="MSIIEFCSVDQIYHAGTSIQKKSLSAVSFNVEQGEMVAVVGATGS
FT                   GKSTLVQHINGILLPYKGQVLVKGVATSEKKHRRSLWRMVGLVFQYPENQLFEDTVYKD
FT                   VAFGPRNLKLPNTEVDRRVRYALKKVGLDYEFIKDESPLNLSGGQKRRVAVAGVLAIEP
FT                   EILVLDEPTAGLEPRVAIDLLRHLKELQLENNTTVLIVTHNLKEVASMVDRVLVLHQAK
FT                   VLFSGTPRELYSRYYNLPGSGLALPPALELMLGLEKRGKKVRTDVLTIDEAVAEILKAC
FT                   KK"
     atgtcaataa tagaattttg ttccgtagat caaatttatc atgccggcac atcaatacaa        60
     aagaaatcat tatccgctgt tagttttaac gttgagcagg gtgaaatggt tgcggttgtc       120
     ggtgctaccg ggtcaggcaa gtctacttta gtgcaacata ttaacggtat tttactgcct       180
     tataaaggcc aggtactggt gaaaggtgta gctacctcag aaaaaaaaca ccggcgttct       240
     ctttggcgta tggtaggttt ggtatttcag tacccggaaa accaactttt tgaagataca       300
     gtgtataaag atgtagcatt tggaccacgt aatctcaaac tgcctaatac tgaggttgat       360
     aggcgtgtaa gatatgcact taaaaaggtt ggtttagatt atgaatttat aaaagacgaa       420
     tcaccattaa atttaagtgg tggtcaaaaa cgccgggtgg cagttgccgg tgttttggct       480
     attgaaccgg aaatcctggt attggatgag cctacggcgg gactggaacc gagggttgcc       540
     atagatctgt tgcgtcactt aaaggaattg caattagaaa ataatacaac tgtgcttata       600
     gtcactcaca atcttaaaga agttgcttcg atggttgata gagtgcttgt actgcatcag       660
     gctaaggttc tttttagcgg tacaccgcgt gaattatatt ccagatatta taatctgcct       720
     ggttcgggtt tggctttacc gcctgcgtta gagctgatgt tgggattaga aaaacgcggt       780
     aaaaaggtgc gtaccgatgt tctgacaatt gacgaagcag tggcggaaat attgaaagcg       840
     tgtaaaaaat ag                                                           852
//

If you have problems or comments...

PBIL Back to PBIL home page