(data stored in ACNUC7421 zone)

EMBL: CP001720.PE307

CP001720.PE307       Location/Qualifiers
FT   CDS_pept        330175..330927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0319"
FT                   /product="tRNA pseudouridine synthase A"
FT                   /EC_number="5.4.99.12"
FT                   /note="KEGG: bsu:BSU01480 tRNA pseudouridine synthase A;
FT                   TIGRFAM: tRNA pseudouridine synthase A; PFAM: tRNA
FT                   pseudouridine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61272"
FT                   /db_xref="GOA:C8W418"
FT                   /db_xref="InterPro:IPR001406"
FT                   /db_xref="InterPro:IPR020095"
FT                   /db_xref="InterPro:IPR020097"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:C8W418"
FT                   /inference="protein motif:TFAM:TIGR00071"
FT                   /protein_id="ACV61272.1"
FT                   /translation="MNRGRNIKVILAYDGTNYHGFQIQKGKRLPTIQGVLQRELSHLAK
FT                   ETITVTTAGRTDSGVHARGQVFNFFTGNWQIPVDRVIYALNSVLPPDIRALSAEEVDLG
FT                   FHARYSALAKTYCYYISRDQIVSPFTRLYSYQYNYPLDLDDMRQAVLHITGEHDFKSFM
FT                   ASGSLVKSTIRTIYQIDLIEKDKMLIFTFRGNGFLYHMVRIITGTLLQVGTGKIHYSEI
FT                   ETILKKCDRKSAGATVPALGLFLERVEY"
     attaaccgtg gtagaaatat caaagttatt ttagcttatg atggcacaaa ttatcacggt        60
     tttcaaatac agaagggcaa gcggttgcct acaatacaag gtgtcttgca gcgggaactg       120
     agccatttgg ccaaggagac cattactgtt acaactgctg gacgtacaga cagcggtgtt       180
     catgccagag gtcaggtttt taactttttt actggcaatt ggcaaattcc tgtagatcgt       240
     gtgatttatg ccttaaacag tgtattaccg cctgatataa gagcgctgtc ggctgaagaa       300
     gtggatttgg gttttcatgc ccgttattcg gctttagcta aaacctactg ctattatata       360
     agcagagatc agatagtatc cccctttacc agactgtaca gttatcaata caactatcct       420
     ctggatttgg atgatatgcg ccaggctgtt ttgcatatta ccggagagca tgatttcaag       480
     tcctttatgg ccagtggcag cctggttaaa tcaacaataa ggacaatcta tcagatagat       540
     ttaatagaaa aagataaaat gcttatcttt acttttcgtg gcaatggttt tttatatcac       600
     atggtaagaa tcattacagg cacactgctt caggttggta ccggtaaaat tcactacagt       660
     gagatagaaa caatactaaa gaaatgtgat agaaaatcgg ccggcgctac agtgcccgcc       720
     ctgggtctgt ttttggagcg ggtggaatac tga                                    753
//

If you have problems or comments...

PBIL Back to PBIL home page