(data stored in ACNUC7421 zone)

EMBL: CP001720.PE308

CP001720.PE308       Location/Qualifiers
FT   CDS_pept        331058..331504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0320"
FT                   /product="ribosomal protein L13"
FT                   /note="TIGRFAM: ribosomal protein L13; PFAM: ribosomal
FT                   protein L13; KEGG: abo:ABO_0576 50S ribosomal protein L13"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61273"
FT                   /db_xref="GOA:C8W419"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR005823"
FT                   /db_xref="InterPro:IPR023563"
FT                   /db_xref="InterPro:IPR036899"
FT                   /db_xref="UniProtKB/TrEMBL:C8W419"
FT                   /inference="protein motif:TFAM:TIGR01066"
FT                   /protein_id="ACV61273.1"
FT                   /translation="MKTFMAKSNEIKRKWWVIDGEGKVLGRLAVEVAKILRGKHHPLYT
FT                   PHVDTGDNVIIVNADKVILTGKKMQQKQYIRHSGYPGGIKMTNYETMMQKNPELMVTKA
FT                   VKGMLPHNSLGRSMIKKLKVYKGSEHPHEAQKPEVWPLSSEGGI"
     ttgaaaacct ttatggccaa gtccaatgaa ataaagcgta agtggtgggt tattgacgga        60
     gaaggcaaag tgctcggtcg tttggcagtt gaagttgcga aaattttaag aggaaaacac       120
     catccactgt atacaccgca tgtggataca ggtgataacg taattattgt taatgccgac       180
     aaggttattt taaccggcaa gaaaatgcag caaaaacagt atatacgtca ttcaggctac       240
     ccaggcggta ttaaaatgac caattatgaa accatgatgc aaaaaaatcc tgagttaatg       300
     gtaactaaag cagttaaagg aatgttgccg cacaacagct taggccgcag catgattaag       360
     aagctcaagg tatataaggg tagcgagcac ccgcatgagg ctcagaagcc agaagtttgg       420
     ccgctgtcgt cggaaggggg aatataa                                           447
//

If you have problems or comments...

PBIL Back to PBIL home page