(data stored in ACNUC7421 zone)

EMBL: CP001720.PE309

CP001720.PE309       Location/Qualifiers
FT   CDS_pept        331505..331897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0321"
FT                   /product="ribosomal protein S9"
FT                   /note="PFAM: ribosomal protein S9; KEGG: bha:BH0169 30S
FT                   ribosomal protein S9"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61274"
FT                   /db_xref="GOA:C8W420"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="InterPro:IPR023035"
FT                   /db_xref="UniProtKB/TrEMBL:C8W420"
FT                   /inference="protein motif:PFAM:PF00380"
FT                   /protein_id="ACV61274.1"
FT                   /translation="MAQVQFYGTGRRKNAVARVYLLPGDGKFNVNNRSMEEYFGRKSLL
FT                   KVIGQPLELTGTTGKFDIKVMVIGGGVSGQAGAVKMGIARALIQADPNLRPVLKKAGFL
FT                   TRDPRMKERRKYGLKKARRAPQFSKR"
     gtggcccagg tgcaattcta tggaacaggt cggagaaaaa atgctgttgc ccgcgtttat        60
     ttattgccgg gtgatgggaa atttaatgta aataatcgct ctatggaaga atattttggc       120
     cggaagtcac tattaaaagt aattggccag ccgttggaat taacaggtac caccggcaag       180
     tttgatataa aagttatggt tataggcggc ggtgttagcg gtcaagcagg cgcggttaaa       240
     atgggtattg cccgtgcatt gattcaggcg gatcctaacc taagacctgt attaaagaaa       300
     gcaggtttct taacccgtga cccgcgtatg aaggaaagaa gaaagtacgg tttgaagaaa       360
     gcccgtcgtg cacctcagtt ttccaaacgt taa                                    393
//

If you have problems or comments...

PBIL Back to PBIL home page