(data stored in ACNUC7421 zone)

EMBL: CP001720.PE31

CP001720.PE31        Location/Qualifiers
FT   CDS_pept        34794..36182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0032"
FT                   /product="ammonium transporter"
FT                   /note="TIGRFAM: ammonium transporter; PFAM: Rh family
FT                   protein/ammonium transporter; KEGG: sfu:Sfum_0727 ammonium
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ACV60996"
FT                   /db_xref="GOA:C8VVC0"
FT                   /db_xref="InterPro:IPR001905"
FT                   /db_xref="InterPro:IPR018047"
FT                   /db_xref="InterPro:IPR024041"
FT                   /db_xref="InterPro:IPR029020"
FT                   /db_xref="UniProtKB/TrEMBL:C8VVC0"
FT                   /inference="protein motif:TFAM:TIGR00836"
FT                   /protein_id="ACV60996.1"
FT                   /translation="MKILRVIIMALSFLMTLPVLAWAEEAAAPAVDTGDTSFILISAAI
FT                   VLLMTPGLALFYGGLSRKKNVLNTIMCSFIALGIISIQWAFYGYSLSFGPDVGHFIGSL
FT                   DWLGLKGVGLEPNPDYAATIPHQAFMVFQMVFAIITPAIISGSVAERMRFPAYLAFILL
FT                   WATFIYDPVAHWVWGVGGWLRNLGALDFAGGTVVHIISGVSALVAAMYVGKRKGYGREL
FT                   MIPHNLPMTVLGASLLWFGWFGFNAGSSLGAGSLTTMVFVNTQLATAAAMLSWVIFEWI
FT                   RHGKPTLLGAVSGAVAGLVAITPACGFVTSMSAIIIGFIGGFICFFSVAIMKAKLGYDD
FT                   SFDAFGVHGMGGTWGAIATGLFASKAANELGNDGVFYGNPDQLVTQLIATAASWAVAVV
FT                   GTLVLLKVISLFTKLRASDEEQETGLDFTQHGEDAYTEFVSGSPFGVDMTAGGAPVGAE
FT                   KPAF"
     atgaaaattt tacgagttat tatcatggcg ctttcctttt tgatgacact gcctgtactg        60
     gcgtgggctg aggaagcggc agcgcccgct gtcgataccg gtgatacgtc ctttatcttg       120
     atttctgcag cgattgttct gttgatgaca ccgggtttag ccctttttta tggcggcctg       180
     tcacgcaaga agaatgtttt gaatactatc atgtgcagct ttatagcctt aggaattata       240
     agtattcaat gggcgtttta cggttacagt ctgtctttcg gccctgatgt ggggcatttt       300
     attggcagcc ttgactggct tggtttaaaa ggtgtgggat tagagccgaa tcccgattac       360
     gctgctacta taccgcacca ggcgtttatg gtattccaga tggttttcgc cattataaca       420
     ccggccatta tttccggttc tgttgccgag cggatgagat ttcccgctta cctggccttt       480
     atactgcttt gggcaacctt tatctatgat cctgtagctc actgggtatg gggtgtagga       540
     ggctggttac gcaatcttgg ggcacttgat tttgccggcg gtaccgttgt gcatatcatt       600
     tccggcgtat cagcgctggt agctgcaatg tatgtgggca agcgcaaagg ctatgggaga       660
     gagttaatga taccgcataa tttacctatg acggttttgg gagcttctct gctgtggttt       720
     ggctggtttg gttttaatgc gggcagttca ttgggcgccg gtagtctgac tactatggtt       780
     tttgttaaca cacagctggc tactgcagca gcaatgctgt catgggtgat ctttgaatgg       840
     atacgtcatg gcaaaccaac tctgttgggt gctgtcagcg gtgcagtggc aggtttggtg       900
     gctatcaccc ccgcatgcgg ttttgtgaca tctatgtcag ccattatcat tggttttata       960
     ggcggattta tatgcttctt ttcagtagct ataatgaaag caaaacttgg ttatgacgat      1020
     tcctttgatg cttttggtgt gcacggtatg ggaggtacct ggggtgctat agctaccggt      1080
     ttattcgcca gtaaagctgc aaacgagctg ggcaatgacg gtgttttcta cggcaatcct      1140
     gatcaactgg tcactcagtt gatagctacc gcggcaagct gggctgtcgc tgttgtaggt      1200
     actttagttt tattgaaagt aatcagcctg tttaccaagc tgcgtgccag tgatgaagaa      1260
     caggagacag gtttggattt tacccaacat ggagaggacg cctataccga gtttgtttcc      1320
     gggtctccgt ttggagttga tatgactgct ggcggtgctc ctgtcggtgc agaaaaaccc      1380
     gctttttaa                                                              1389
//

If you have problems or comments...

PBIL Back to PBIL home page