(data stored in ACNUC7421 zone)

EMBL: CP001720.PE312

CP001720.PE312       Location/Qualifiers
FT   CDS_pept        333967..335370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0324"
FT                   /product="AMMECR1 domain protein"
FT                   /note="PFAM: AMMECR1 domain protein; Extradiol ring-
FT                   cleavage dioxygenase class III protein subunit B; KEGG:
FT                   glo:Glov_0529 AMMECR1 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61277"
FT                   /db_xref="GOA:C8W423"
FT                   /db_xref="InterPro:IPR002733"
FT                   /db_xref="InterPro:IPR004183"
FT                   /db_xref="InterPro:IPR023473"
FT                   /db_xref="InterPro:IPR027485"
FT                   /db_xref="InterPro:IPR027623"
FT                   /db_xref="InterPro:IPR036071"
FT                   /db_xref="UniProtKB/TrEMBL:C8W423"
FT                   /inference="protein motif:PFAM:PF01871"
FT                   /protein_id="ACV61277.1"
FT                   /translation="MSLVYSAVCPHPPIVVPEVGGKEAAQVKNTAEAMLEIGRRIKSSG
FT                   AEILIMISPHSPVFEDAIAIHGNKTLHGNLGRFGASQVAFTLTCETGLVEQIIKTANEN
FT                   GILAVELNQQLAGKYKISLELDHGLMVPLYFLRQSGVELPVVAIAVGLLPFEELYAFGI
FT                   AVQRAVQNYSKKAALLASGDMSHCLKKGAPCGYDPKGEEFDRAIVRLTAAADVEGIIGM
FT                   QPELLERAAECGFRPLLMLLGALDGYKIKSEVLSYEGPFGVGYMVASLAPQEISLDRKF
FT                   SHRWLEIREEQVALRRSNESYLVQLARNSLESNILGKSMDMDTGQAPPEFRKKSGVFVC
FT                   IKKEGRLRGCIGTVFPQQKSIADEVVVNAVSAGLHDHRFPRVQPEELSDLVYSVDVLTE
FT                   PEAISSIKQLDPAKYGVIVRSGHKSGLLLPNLEGVDNVEQQVQIAREKAGIRVDQDVSL
FT                   ERFEVIRYS"
     atgtcactgg tttatagtgc agtgtgtcct cacccgccta tagttgtccc ggaagttgga        60
     ggaaaggaag ccgctcaggt taaaaacacg gcggaggcta tgttggaaat aggcaggaga       120
     attaaaagca gcggtgctga aatattaatc atgatatcac ctcacagccc ggtgtttgag       180
     gatgcgatag ctattcacgg caacaagact ttgcatggaa acttgggacg gtttggcgct       240
     tcacaagtgg cgtttacttt aacctgtgag accggcctgg ttgaacaaat tataaaaacg       300
     gccaatgaaa acgggatact ggcagttgag ctcaatcagc agctagcggg taagtataaa       360
     atcagtttgg aactggacca cggcttaatg gttccactgt attttctgcg acagtcagga       420
     gtggaactgc ctgtggtagc aattgctgtg ggattactgc cttttgaaga actatatgcc       480
     tttggtatag ctgtccaaag agcagtgcag aattatagca aaaaggctgc tcttttggcc       540
     agcggagata tgtctcattg cttaaaaaaa ggtgctcctt gcggctatga tcccaagggc       600
     gaggaatttg accgggcgat tgtacgtctg accgctgctg ctgatgtcga aggaataatc       660
     gggatgcagc cggaactgtt agagagagcc gctgagtgtg gctttcgccc gctgctgatg       720
     ctgcttggcg cattagacgg ctataaaatc aaatcggaag ttcttagtta cgaaggcccg       780
     tttggtgtgg gttatatggt tgcctctctg gcaccgcaag aaatatcgtt agatagaaaa       840
     ttcagccaca ggtggttgga aataagagaa gaacaagtag cgctgcgccg cagtaatgag       900
     agttatttgg tgcagcttgc cagaaacagt ttggaaagta atatattggg taagtctatg       960
     gatatggata cagggcaggc gccgcccgaa tttagaaaaa agtccggagt ttttgtctgc      1020
     atcaaaaaag aaggtcgcct aagaggttgt attggtacag tttttcccca gcaaaagagt      1080
     attgccgacg aggtagttgt caacgcggtg agcgccggtc tgcacgatca ccgttttcca      1140
     cgggtgcagc cagaggaact gtctgatctg gtttacagcg tggatgtatt gactgaacct      1200
     gaagctataa gcagtattaa acagcttgat cccgcgaaat acggtgtaat agttcgcagc      1260
     gggcataagt caggattgtt attgcctaat ttggaaggcg tggacaacgt ggaacaacag      1320
     gtgcaaatag ccagagaaaa agccggtatt cgggttgatc aagatgtttc actggaacgc      1380
     tttgaagtaa ttagatacag ttaa                                             1404
//

If you have problems or comments...

PBIL Back to PBIL home page