(data stored in ACNUC7421 zone)

EMBL: CP001720.PE314

CP001720.PE314       Location/Qualifiers
FT   CDS_pept        336604..337260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0326"
FT                   /product="Rhomboid family protein"
FT                   /note="PFAM: Rhomboid family protein; KEGG: dal:Dalk_3454
FT                   rhomboid family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61279"
FT                   /db_xref="GOA:C8W425"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:C8W425"
FT                   /inference="protein motif:PFAM:PF01694"
FT                   /protein_id="ACV61279.1"
FT                   /translation="MIPLKDDIPSSRFPLVNISLIIVNLVIFVYLVLNNNLDVYIMTHG
FT                   VVPKDFFSDFSPFTQFYLFTIAIFLHGGWLHVLGNMLYLWIFGDNVEDRMGHFRYLIFY
FT                   MICGYTATLAHVLADPLSTMPMVGASGAIAGVLGAYLVLFPRARVLTLLPIFFFITFIR
FT                   IPAVLFLAFWFILQIFNGMVSGSAGVAWWAHIGGFIVGMLLVKFMEKKKNKYFFS"
     atgattccct taaaagatga tatcccttca agccggtttc ctctggttaa tatatcttta        60
     atcatagtta atttagttat atttgtatat ttggttttaa ataataattt ggatgtttat       120
     attatgacac atggtgtggt accgaaagat ttttttagtg atttttcccc ttttacacag       180
     ttttatttgt ttaccattgc tatattcctt cacggcggat ggttgcacgt gctgggaaat       240
     atgctgtatt tatggatatt cggtgataat gtcgaggatc gtatggggca ttttcgctat       300
     ctgatttttt atatgatttg cggttataca gctacactgg cgcatgtgtt ggcagatccg       360
     ctttctacta tgcctatggt tggtgccagc ggtgccattg cgggtgtatt gggagcatat       420
     ttggtattgt ttccgcgggc cagagtttta acattgctgc cgattttttt ctttataacc       480
     tttattcgta ttccggccgt attgtttctg gccttttggt ttattctaca aatattcaat       540
     ggtatggtta gtggttctgc cggagtggcc tggtgggccc atatcggagg atttattgta       600
     ggcatgcttt tagtgaaatt catggaaaaa aagaagaaca aatatttttt ctcttag          657
//

If you have problems or comments...

PBIL Back to PBIL home page