(data stored in ACNUC7421 zone)

EMBL: CP001720.PE315

CP001720.PE315       Location/Qualifiers
FT   CDS_pept        337369..338340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0327"
FT                   /product="putative SAM-dependent methyltransferase"
FT                   /note="KEGG: dat:HRM2_33640 putative SAM-dependent
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61280"
FT                   /db_xref="GOA:C8W426"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:C8W426"
FT                   /inference="similar to AA sequence:KEGG:HRM2_33640"
FT                   /protein_id="ACV61280.1"
FT                   /translation="MLNLISIFYHEGLTLSRELFHGFFIFKQERKIKLQISQVRSREFW
FT                   ENAWKEARDNSPMVRRRCRIEQEMVDNWNRRAQWFARRTSGARGEQRQKAVFDMLEQQG
FT                   VLNSEVKVLDVGAGPGNFAVPMARLVREVTALEPAQEMIKIMEDRASTEELSNINIIQR
FT                   TWQDINVEEDGLAGGFDLVFASMTPGVQDPETLQKLIAASKKYCYYSSFSGNRWSKAYH
FT                   DLWRCFFNEDMGDNPGDIIYPLNLLYALGYRPSLHFFTNRQVQEQPAAEAVEELLKFFW
FT                   SYIDITSEVRQVVEEYVQKNVQDGILCQSTTVSYGMLLWRVD"
     ttgttaaact taataagcat attttaccat gaaggtttaa ctctcagtag agagttgttt        60
     catggttttt ttatttttaa acaagagagg aagataaaat tgcaaatatc acaagtaagg       120
     agccgtgagt tttgggaaaa cgcttggaaa gaagccaggg acaactcacc gatggtacgc       180
     aggcgctgcc gcattgaaca ggaaatggta gataactgga accggcgtgc ccagtggttt       240
     gcccggcgta caagcggtgc gaggggcgag cagaggcaga aagcagtatt tgatatgctg       300
     gaacagcagg gtgttttaaa ttcagaggtt aaggttttgg atgtcggggc aggtccgggt       360
     aattttgctg ttcctatggc tcgcttggtc agggaggtta ccgctttaga acccgctcag       420
     gaaatgatta aaatcatgga agacagggcc agtaccgaag aattaagtaa tattaatata       480
     atccagcgca cctggcagga tataaatgta gaggaagacg gtttggcagg aggttttgat       540
     ttggtatttg cctcaatgac acctggggtt caggatccgg aaacactgca aaaactaatt       600
     gccgcatcaa agaaatactg ctattacagt tctttttccg gtaatcgctg gagtaaagcc       660
     tatcatgatc tctggcggtg ttttttcaat gaggatatgg gtgataatcc gggggacatc       720
     atttatccct tgaatttact ctatgctttg ggttaccggc ccagccttca cttttttacc       780
     aaccggcagg tgcaggaaca gccggcggcg gaagcagttg aagagctgct aaaatttttc       840
     tggagttata ttgacattac ttcagaggtc agacaggtag tagaagagta tgtgcagaaa       900
     aacgttcagg atggtatcct ttgccaatca accaccgtta gttacggtat gttgctgtgg       960
     cgggttgatt aa                                                           972
//

If you have problems or comments...

PBIL Back to PBIL home page