(data stored in ACNUC7421 zone)

EMBL: CP001720.PE316

CP001720.PE316       Location/Qualifiers
FT   CDS_pept        338532..340154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0328"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /note="PFAM: extracellular solute-binding protein family 5;
FT                   KEGG: wsu:WS1160 oligopeptide binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61281"
FT                   /db_xref="GOA:C8W427"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:C8W427"
FT                   /inference="protein motif:PFAM:PF00496"
FT                   /protein_id="ACV61281.1"
FT                   /translation="MFRKNLLIKIVLTLLFSLSLLLSGCGTDKSGNVKETNADGGEAQV
FT                   DLIKLGGGDWGYPTPYAHYPRGPGSFKMAMIFDSLLERDEKGLIPWLAEKYEIKEDGKQ
FT                   YLFTVRNGVKWQDGKPLTAEDVKFSIEYASKYPMVSSDIGSKDIEKVETAGEKQVLVTV
FT                   AQPSAGMLYNLGHTRIIPKHIWEKIDKPKEFTQPEAVIGSGPYRLTDYNKEHGTYRFEA
FT                   FEDFWGPKQRVKVVEFVPVSESILAFENGEIDLAGVTPDVLSRFQKDQQYKIVKSPGFW
FT                   GYRLLFNMKDNPILQQKELRQAISYAMDKNELIEKVARGAAIPGSAGILPPDHVMYNPK
FT                   AKQYELNLKKAEELLVQLGYDSLDEKSIRKNKDGSSLSFNLLVGGEVRLAEVLKEQLAK
FT                   AGIGLKVQSVDSKSRDARVLKNEYQLAVTGHGGWGGDPDYLSERFTSVSKGASSPSAAA
FT                   LRGYNNVELNTLLEKQNLAMDEQKRKKLVFDIQNILAEDVPEIPIYYTTGYSVYKPAKY
FT                   DGWMFMFDHHELSHSKLSYLERN"
     atgttcagga aaaatttatt aataaaaatt gtcctgacct tgcttttttc actcagtttg        60
     ctcctgtcgg gttgtggcac ggataaatca gggaatgtca aagaaactaa tgcagatggg       120
     ggagaagcac aggtagacct tattaagttg ggcggagggg actggggtta cccgactcca       180
     tatgctcatt atcccagggg tcccggttca tttaaaatgg ctatgatttt tgatagtctt       240
     ttagagcggg atgaaaaagg acttattccc tggctggctg aaaaatatga aattaaggaa       300
     gacggcaagc aatacttgtt taccgttaga aacggtgtca agtggcagga tgggaaacct       360
     ttgaccgctg aggatgttaa gttttctatt gaatatgcaa gtaagtatcc tatggtgtcg       420
     tcggatattg gaagtaaaga cattgaaaaa gtagagacgg caggggaaaa gcaagttttg       480
     gtgacggtag cgcagccctc cgccggaatg ctctataatt tgggccatac ccgtatcatt       540
     cccaagcata tatgggaaaa gattgataag cccaaggaat ttactcaacc ggaggcagtt       600
     attggcagcg ggccttaccg tttaacagac tacaataagg aacacggtac ctatcgtttt       660
     gaggcttttg aggatttctg gggaccaaag caaagagtta aagtggttga atttgtacct       720
     gtcagtgaga gtattctggc ttttgaaaac ggtgaaattg atttagcagg cgttacacct       780
     gatgtattgt ctcgttttca aaaggatcag cagtataaaa ttgtaaaaag ccctggtttc       840
     tggggatatc gtttgctctt caatatgaaa gataatccca tattacagca aaaggaactg       900
     agacaagcaa tcagctatgc tatggataaa aacgaactga tcgaaaaggt tgcccgtggg       960
     gctgctattc ccggcagcgc aggcattctg cctcctgatc atgtaatgta caatcctaag      1020
     gctaaacaat atgaattgaa tcttaaaaaa gcggaagaat tattggttca attgggttat      1080
     gacagtttgg atgaaaaaag tattcgtaaa aataaagatg gttccagtct ttctttcaac      1140
     ctgttggttg gcggtgaagt tagactggcg gaagtactaa aagaacagtt ggctaaagca      1200
     ggtattggat taaaagtaca aagtgtagac agcaaaagcc gggatgctcg agtgctgaag      1260
     aatgaatatc agcttgctgt taccggacat ggcggatggg gtggcgatcc tgattacttg      1320
     agcgaaagat ttaccagcgt gtctaaggga gcaagttccc cttctgccgc cgcgctgcgt      1380
     ggctacaata atgttgagtt gaatacttta ttagaaaaac agaacctggc aatggatgag      1440
     cagaagcgta agaaattagt ttttgatatt caaaatattt tagctgaaga tgtaccggaa      1500
     atccctatct actatactac cggttattct gtctataaac cggccaagta tgatgggtgg      1560
     atgtttatgt ttgatcacca tgaattatca cacagcaagc tttcttacct ggaaaggaat      1620
     tga                                                                    1623
//

If you have problems or comments...

PBIL Back to PBIL home page