(data stored in ACNUC7421 zone)

EMBL: CP001720.PE317

CP001720.PE317       Location/Qualifiers
FT   CDS_pept        340161..341141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0329"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: scl:sce4301 peptide ABC
FT                   transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61282"
FT                   /db_xref="GOA:C8W428"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C8W428"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACV61282.1"
FT                   /translation="MNKQRVTKLAEYVFTVWIIVTINFMLPRSMPGDPFLHLSADEGEE
FT                   ITVFSEEQRKYYLAYYGLDRPAGEQYLSYLSELLQGNMGYSLYYNEPVSTIILRRLPWT
FT                   AFLVTAAVALSTVIGAFLGSISAWYRGKWADKFLFFNLILLSEIPAFLLALILLFTLAA
FT                   GLGLFPLSGAMTHFANYDSWLEKLWDIIHHVFLPTMALTVTRLGSMYLLSRNSMITVLA
FT                   KDYLRTAQAKGLSRKRIIFSHALRNSLLPIVTRVFLSLGSLVGGAILVENVFAYPGLGH
FT                   LMREAVMFHDYPLVQGIFLAVTVCVLTANFLADLIYRKIDPRIAG"
     ttgaacaagc aaagggtcac caaactggcg gaatatgttt ttactgtttg gattatagtg        60
     actatcaatt ttatgcttcc ccggtctatg ccaggtgacc cctttttgca cttgtcagct       120
     gatgaaggtg aggagattac ggtattttcg gaagaacaaa ggaaatacta tcttgcctat       180
     tatggtttgg atcgtcctgc cggtgaacag tatctttcct atctttctga attgctgcaa       240
     ggaaatatgg gctacagtct ctattacaat gaaccggtaa gcacgattat tttgcgcagg       300
     ctgccgtgga cagccttttt ggtaacggca gcagtggctt taagtactgt tataggcgct       360
     tttttaggca gcatatcggc ctggtaccgg ggaaagtggg ccgataagtt cttgtttttt       420
     aacttaattt tattatcaga gattcctgct tttctactgg cgcttatctt actttttacc       480
     ctggctgcag gtttaggctt attcccttta tcgggtgcta tgacacattt tgcaaattat       540
     gatagctggt tggaaaagct ttgggatata atacaccatg tttttttgcc cactatggcc       600
     ctgacagtca ccaggttggg cagtatgtat ttgctttcca gaaacagtat gataactgta       660
     ttggcaaagg attatctgcg tactgcccag gctaaggggc tttcccggaa gcgcattatt       720
     tttagccatg ctttgagaaa ctccctgctg cccatagtaa caagagtctt tttaagtctt       780
     ggttccttgg taggaggggc gattttggtg gaaaatgtat ttgcttatcc tggattggga       840
     catctaatga gagaagcggt gatgtttcac gattacccat tggttcaggg aattttttta       900
     gcggttactg tgtgtgtttt aacggctaat tttttagctg atttaattta tagaaagatt       960
     gacccgcgga ttgccggtta a                                                 981
//

If you have problems or comments...

PBIL Back to PBIL home page