(data stored in ACNUC7421 zone)

EMBL: CP001720.PE319

CP001720.PE319       Location/Qualifiers
FT   CDS_pept        342100..343821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0331"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="KEGG: noc:Noc_0936 oligopeptide/dipeptide ABC
FT                   transporter, ATPase subunit; TIGRFAM:
FT                   oligopeptide/dipeptide ABC transporter, ATPase subunit;
FT                   PFAM: ABC transporter related; Oligopeptide/dipeptide ABC
FT                   transporter domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61284"
FT                   /db_xref="GOA:C8W430"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C8W430"
FT                   /inference="protein motif:TFAM:TIGR01727"
FT                   /protein_id="ACV61284.1"
FT                   /translation="MTADVKYLLEINDLSVTYDTVHPPVTAVDGISLQLRKGESLGIIG
FT                   ESGCGKSSLALAIMGLIKEGRVTGNIVFKGHNLTGLSESELRKYRWDNIAMVFQNSLEV
FT                   LNPVLSIGKQIGEPLKSHYGLDSAEINRKVIELLTAVGLEPEWRNCYPHQLSGGMRQRV
FT                   LLAMALACEPELLLVDEPTTALDPSSKNEILYLLKKLQKKLNFTMILISHDLGTIKKLT
FT                   SRVMTMYCGQVVEAGITSEVIKSPMHCYTRGLMNSSPNFFKYKDLWGIGGEPPSGSIAE
FT                   GCTFYSRCCQREETCSQSRPSLEYVALERLVACHKGGIETLLKAEGISKKYTLINKEIE
FT                   AVKGASLEIRSGEVVALVGESGSGKSTLAHILAGVLPVDAGQVFFKNRKIEGRWSTKMI
FT                   GGMQIIFQDSFSSTSHRMKVLEVAREPLDIIKWGSKKEREQAATEALQTVQLPVSPEFL
FT                   QRYCCALSGGQRQRLAIARALSTKPKLLIADEVTSMLDPSTQANLLRELKWLQNSCGFA
FT                   MLYITHDLHLARKISDRVYVMYQGEIVETGAAFEIFENPEHVYTKQLLQDAFSDLV"
     gtgactgcag atgtaaagta tttgctggaa ataaatgatt tgtcggtaac ttatgatact        60
     gtgcaccctc cggtgacagc tgttgacggt atttcccttc agcttagaaa aggggaaagt       120
     ctgggaatta tcggcgaatc aggctgtgga aaaagttctt tagctttggc aattatgggc       180
     ttgataaaag agggtagagt tactggtaat atagttttta aaggtcataa tttaacaggt       240
     ttgtcggaaa gtgaactgcg caaatatcgt tgggacaata ttgccatggt atttcagaat       300
     tcgctggagg ttctcaatcc cgtgctcagc attgggaagc aaataggaga gcctctaaag       360
     agccactatg gcttagattc agcagagatt aaccgcaaag ttattgaatt attaactgca       420
     gtaggtctgg aacctgagtg gagaaactgt tatccgcatc aattgtcagg aggtatgaga       480
     cagagggttc tcttagccat ggctttagcc tgtgaaccgg aattgttgct tgtggacgaa       540
     cctaccacgg cgttggatcc ttcaagtaaa aatgaaatac tgtatctact taaaaaatta       600
     cagaaaaaac ttaattttac catgatttta atctctcacg atttgggaac tattaaaaag       660
     ctcacctcca gggttatgac catgtactgc ggtcaagtgg ttgaagcagg gattacttca       720
     gaggtaatca aaagccctat gcattgctat accaggggtt tgatgaattc ttcccccaat       780
     ttttttaaat ataaagattt gtggggtatt ggcggggaac caccttcggg aagtatagcg       840
     gagggctgta ccttttattc acggtgctgc cagagggaag aaacctgttc tcagtccagg       900
     ccttctctgg aatacgtggc tcttgaacga ctggtggcct gtcacaaggg aggcattgaa       960
     accttactta aggctgaagg gattagtaaa aaatatactt tgatcaacaa agaaattgaa      1020
     gcggttaaag gagccagcct ggaaatcaga agtggtgagg tagtagcgtt ggtgggagaa      1080
     tccggttcag gcaaatctac acttgctcat attttagcag gtgttttgcc ggttgatgcg      1140
     ggccaggtat tctttaaaaa cagaaaaatt gaaggaagat ggtccactaa aatgataggc      1200
     gggatgcaga ttatttttca ggattctttt tcttccacca gtcaccgtat gaaggttttg      1260
     gaggttgcca gggagccgtt ggatataatc aaatggggca gtaagaaaga aagagaacag      1320
     gcagcgacag aggctttaca gacagtgcag cttccggttt cccctgaatt cttgcagcgg      1380
     tattgctgtg ctttgagtgg aggacagaga cagcgtttgg ctatagccag ggcactgtca      1440
     acaaaaccaa agttattgat tgcagacgaa gtaacgtcga tgctggatcc ttcaactcag      1500
     gccaatcttt taagagaact caagtggctg caaaatagct gtggttttgc catgctgtat      1560
     attactcatg atttgcacct ggccagaaag atatctgata gggtatatgt tatgtaccag      1620
     ggtgaaattg tggaaacggg cgcagccttt gaaatatttg agaatcctga gcatgtgtac      1680
     actaagcagc ttttgcaaga tgctttcagt gatttggttt aa                         1722
//

If you have problems or comments...

PBIL Back to PBIL home page