(data stored in ACNUC7421 zone)

EMBL: CP001720.PE321

CP001720.PE321       Location/Qualifiers
FT   CDS_pept        345224..346132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0333"
FT                   /product="periplasmic solute binding protein"
FT                   /note="PFAM: periplasmic solute binding protein; KEGG:
FT                   dds:Ddes_1008 periplasmic solute binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61286"
FT                   /db_xref="GOA:C8W432"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="UniProtKB/TrEMBL:C8W432"
FT                   /inference="protein motif:PFAM:PF01297"
FT                   /protein_id="ACV61286.1"
FT                   /translation="MRKNVLLITILAIVFTVFLSGCQVQPTMAPGKTEANKTLNIVTSF
FT                   YPMYIATINVANNIPGVKVINMTPPMTGCLHDYQLRPDDLKTLSDAQIFVINGAGMEAF
FT                   MDKVVSQQPNLKIVDATKGIQLIKGHGEEGDNPHVWVSITNAMQQVKNIGLQLAALDPE
FT                   HAAQYSANTNIYTNKLEVLRVKMHQAIDGAKNRDIITFHEAFPYFAQEFNLRIVSVIER
FT                   EPGSEPSAAELADTIEIIKKSNIKALFSEPQYSVKAAETIANETGAKMYTLDPAVTGPM
FT                   EPNGYIKIMESNMEILQKALN"
     atgcgtaaaa atgtattatt gatcacaata ttagcaattg tttttactgt ttttttatcg        60
     ggttgccagg tacaacctac tatggctccg ggaaaaacag aagctaacaa aacacttaac       120
     attgtcacat cattttatcc tatgtatata gcaactatta atgttgccaa taatatacca       180
     ggtgtaaaag ttattaatat gacaccacct atgaccggtt gtttgcatga ttatcaatta       240
     aggcctgatg atttaaaaac acttagtgat gctcagatat tcgttataaa cggcgccggc       300
     atggaggcat ttatggataa agtagtaagt caacaaccaa atttaaaaat tgttgatgca       360
     accaagggta tacaacttat taaaggccac ggagaggaag gcgataatcc tcacgtatgg       420
     gtaagtataa caaacgctat gcagcaggta aaaaacattg gcttgcaatt ggctgctctt       480
     gatccggagc atgctgctca gtatagtgct aataccaaca tttacacaaa taagcttgag       540
     gttctccgtg ttaaaatgca ccaggcaata gatggagcta aaaaccggga tattattact       600
     tttcacgaag catttcccta ttttgcccag gaatttaacc tccgcattgt atctgttata       660
     gaaagggagc caggttcaga accaagcgct gctgaattgg cagataccat tgaaatcatt       720
     aaaaaatcca atattaaggc acttttctct gagccccagt attctgttaa agctgctgag       780
     actattgcca acgaaaccgg ggcaaaaatg tatactttag atccagcggt aaccggtccc       840
     atggaaccga atgggtatat aaaaataatg gaatccaaca tggaaatctt acaaaaggcg       900
     ttgaattaa                                                               909
//

If you have problems or comments...

PBIL Back to PBIL home page