(data stored in ACNUC7421 zone)

EMBL: CP001720.PE323

CP001720.PE323       Location/Qualifiers
FT   CDS_pept        346948..347799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0335"
FT                   /product="ABC-3 protein"
FT                   /note="PFAM: ABC-3 protein; KEGG: dds:Ddes_1010 ABC-3
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61288"
FT                   /db_xref="GOA:C8W434"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:C8W434"
FT                   /inference="protein motif:PFAM:PF00950"
FT                   /protein_id="ACV61288.1"
FT                   /translation="MMAIWYNMVDYVLPFAWAHHIFMKNALLAVLLVGPMFAIIGTMVV
FT                   SNRMAFFSDTIGHSALTGIAIGVILGYQDPLWIMTFFSIFLAIVVSILKSVSSVSTDTI
FT                   IGVVSATMVSLGIVILSRGGGFNKFSRFLIGDLLSITPREVLLLALTLGGVILLWFIMF
FT                   NKFLMVSINHSLALSRGIPIRLIEILFCIATAVIITISIQWVGVLIINSLLILPAAAAR
FT                   NIAENMRQYHIIAILISIISGIAGLISSYYLSTATGATIVLFAAMFYIGTFLQKFRLFK
FT                   FR"
     atgatggcaa tatggtataa tatggttgat tatgttttgc cctttgcctg ggcacatcat        60
     atctttatga agaacgcttt gttggcagta ttattggttg gtcccatgtt tgctattata       120
     ggaacaatgg ttgtaagcaa taggatggct tttttttctg atacaatagg acattctgct       180
     ttgactggca tcgctatagg tgtaattctg ggttaccagg atccgttgtg gattatgacg       240
     tttttttcta tatttctggc tattgttgtt tcaatattaa aatctgtttc ttctgtttcc       300
     actgatacaa ttataggggt ggtttctgct accatggtat ctttgggaat tgttattctc       360
     tctcgcggag gtggttttaa caagttttca cgctttctaa ttggcgattt attgagtatt       420
     acccccagag aggtattatt gttggcgctt acgcttggtg gagtcattct tctttggttt       480
     atcatgttca acaagttctt aatggtcagc ataaaccact ccctggcgct cagcagaggt       540
     attccgatcc gcttgataga aattctattt tgtattgcaa ctgcggttat tataactatt       600
     tcgattcaat gggttggtgt tttaattatc aattcactat tgattttacc ggctgctgca       660
     gcacgtaata tagcagaaaa tatgcgacag taccatataa ttgccatact gataagcatt       720
     atttcaggaa tagcaggact gatatcatca tactacttat caacagcaac aggagcaacc       780
     atagtgttgt ttgcagcgat gttttatata ggtacgtttt tacaaaaatt taggctattt       840
     aagtttaggt aa                                                           852
//

If you have problems or comments...

PBIL Back to PBIL home page