(data stored in ACNUC7421 zone)

EMBL: CP001720.PE326

CP001720.PE326       Location/Qualifiers
FT   CDS_pept        349783..350784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0338"
FT                   /product="cobalamin synthesis protein P47K"
FT                   /note="PFAM: cobalamin synthesis protein P47K; cobalamin
FT                   synthesis CobW domain protein; KEGG: swd:Swoo_3483
FT                   cobalamin synthesis protein P47K"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61291"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR011629"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C8W437"
FT                   /inference="protein motif:PFAM:PF02492"
FT                   /protein_id="ACV61291.1"
FT                   /translation="MGKKIPVTIISGFLGAGKTTLIQKLLEECFQGERIFLLENEFGRV
FT                   GIDGSLLSQYKVEMREIYSGCICCSLKGDFTNALIDALDKVKPQRILIEPTGVGKLSEI
FT                   ISVLEQSIFQDKLAIDQIITVVDAQKSLSFLKNFGEFFKDQVRRAKTLILSKTQKVAWQ
FT                   EVQTLIQELRILNSEALCVTTPWNQLTGTQILSKGTSLEKYLNLVNSPVSAKPTFRIKF
FT                   GTQHRSGHSGVAHTTKEAFQSWSWESPKVFKEAALEKLLSRLEKETSFGTVIRAKGFVP
FT                   GLNGWLHFEYVSGDWNISTGSPQSIGRAVVIGQGLQEERLKHLFGGAVYEGC"
     atgggtaaga aaattcctgt tactattatt tcaggttttt tgggagcagg taaaacaact        60
     ttgattcaaa aactgttgga ggaatgtttt caaggcgaaa gaattttttt attggaaaat       120
     gaatttggac gggtaggcat agatggttct ttactttctc aatataaagt ggagatgaga       180
     gaaatatatt caggttgtat atgttgttcc ttgaagggtg attttactaa cgcattgatt       240
     gatgcactgg acaaagtaaa accccaaaga attttaattg agcccaccgg agtaggtaaa       300
     ctttcagaaa tcattagtgt tttggaacaa tccatatttc aagataaatt agcaatagac       360
     cagatcatca cggtagttga tgcccaaaag tccctgagct ttcttaagaa cttcggtgaa       420
     ttttttaaag accaagtgcg tcgtgccaaa accctgattt taagcaaaac acaaaaggta       480
     gcctggcaag aggtccagac actgatacag gagcttcgta ttttaaattc ggaggcctta       540
     tgtgtgacta ctccctggaa ccaattaacc ggaacacaaa ttctctccaa gggcacctct       600
     ttagaaaaat atttaaatct tgtaaattca ccagtctcgg caaaacccac gtttcgtata       660
     aaatttggta cccagcacag aagtggacac tccggtgtag cccacacaac aaaagaagct       720
     ttccagagtt ggtcctggga aagcccaaag gttttcaaag aagctgcctt agaaaaatta       780
     ttgtcaaggc tggaaaagga gacgagcttc ggaacggtta tacgtgctaa aggatttgtg       840
     ccgggattga atggatggtt gcatttcgaa tatgtcagcg gcgattggaa catttctacc       900
     gggtccccgc agtctatcgg acgggcagtt gttattggtc aaggtttaca agaggaacgc       960
     ttgaaacatc tctttggagg cgcggtttat gagggttgtt ga                         1002
//

If you have problems or comments...

PBIL Back to PBIL home page