(data stored in ACNUC7421 zone)

EMBL: CP001720.PE328

CP001720.PE328       Location/Qualifiers
FT   CDS_pept        complement(351660..352802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0340"
FT                   /product="Metal-binding domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61293"
FT                   /db_xref="InterPro:IPR003814"
FT                   /db_xref="UniProtKB/TrEMBL:C8W439"
FT                   /inference="protein motif:COG:COG5643"
FT                   /protein_id="ACV61293.1"
FT                   /translation="MRKTTAVCVLLCMLFVLPGLVLAQGTTADIENLVGKGKVTSLHLL
FT                   GVKATNIAMQQLSFTKGDANVLAMTDAGYSIISGQTTEKCIDGVIAASGCTTGGSNLLM
FT                   IHRSKELPLWFAFFKEDTRDFIYLQVNSAVVNKSVDELNKLADNQIFNIIAKENIKLDD
FT                   LYNNPDKWNEKINNKVFGGNESSLIGIASIWAHPKCTFDFLQAAQFHNHICPGVNSGYL
FT                   ISKYLDKNLPLQQGQSYKIFAVPSWCKDDALQVIYDATVGKKGMFASDLTEEQKKMLPD
FT                   NAKGVAGIYIRWDAKTNTGSGLVLAFDFDKASELAGVQNAAGPFVKLKTALTMMDYVNQ
FT                   PEIMVSTLKQFNVASAEELTALQAAGVNPLIKLGIMEEVK"
     atgagaaaaa caacagcagt atgtgtattg ctgtgcatgc tttttgttct cccgggcctt        60
     gttttagccc aggggacaac agcggatata gaaaatttag ttggtaaagg aaaggtaacc       120
     tccctgcatt tattaggcgt caaagcgaca aatattgcaa tgcagcagtt atcctttact       180
     aaaggcgatg ctaatgtact ggccatgact gatgccggtt attcgattat tagcggtcaa       240
     actaccgaaa aatgtattga cggtgtaata gccgcttcag gatgtaccac aggcgggagc       300
     aatttattga tgattcaccg cagtaaagaa ctgcctcttt ggtttgcttt tttcaaggaa       360
     gacaccagag attttatcta cctgcaagta aacagcgcag ttgttaataa atccgtagat       420
     gaacttaata aacttgccga caaccagata tttaatatta ttgccaaaga aaatataaag       480
     ttagatgact tatataataa tcctgataaa tggaatgaaa aaataaataa caaagtattc       540
     ggtggaaatg aatcaagctt aataggcatc gccagtattt gggcacaccc caaatgcacc       600
     tttgattttt tgcaggccgc ccaatttcat aatcatatct gcccgggtgt gaacagcggg       660
     tatttaataa gtaaatattt ggataagaat ttacctttac aacaaggaca atcatataaa       720
     atttttgctg tcccatcctg gtgcaaagat gacgctctac aggtaatata tgatgcaacg       780
     gtcgggaaaa agggtatgtt tgcaagcgat ctgactgaag aacagaagaa aatgcttcct       840
     gacaatgcca aaggagttgc cggaatatac attcgctggg acgcaaaaac aaataccgga       900
     agcgggttgg ttctggcttt tgactttgat aaagccagtg aattggcagg ggtgcaaaac       960
     gctgcgggtc cttttgtgaa actaaaaacc gcgttaacca tgatggatta tgtaaatcag      1020
     ccggaaatca tggtttcaac attgaaacaa tttaacgttg ccagtgcaga ggaacttaca      1080
     gcactccaag cagcgggagt aaatcctttg attaagcttg gcataatgga ggaagttaaa      1140
     tag                                                                    1143
//

If you have problems or comments...

PBIL Back to PBIL home page