(data stored in ACNUC7421 zone)

EMBL: CP001720.PE329

CP001720.PE329       Location/Qualifiers
FT   CDS_pept        complement(352845..353297)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0341"
FT                   /product="protein of unknown function UPF0066"
FT                   /note="PFAM: protein of unknown function UPF0066; KEGG:
FT                   dal:Dalk_5286 protein of unknown function UPF0066"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61294"
FT                   /db_xref="InterPro:IPR023368"
FT                   /db_xref="InterPro:IPR023370"
FT                   /db_xref="InterPro:IPR036413"
FT                   /db_xref="InterPro:IPR036414"
FT                   /db_xref="InterPro:IPR040372"
FT                   /db_xref="UniProtKB/TrEMBL:C8W440"
FT                   /inference="protein motif:PFAM:PF01980"
FT                   /protein_id="ACV61294.1"
FT                   /translation="MVNYILKPIGRIISDYKEKSQAPFQGRFKENISYLEINQEYMAGL
FT                   KDIETVSHIIVLYWGHLSDRETLLAKTPFGEEPRGVFSCRSPNRPNPVAVCVAQLLEVK
FT                   DNILKVKGVDALDQSPLLDIKPYSNKVDMVPDACIGWLESVQSAKQ"
     atggtaaact atattttaaa accaatcggc agaataatca gcgattataa ggaaaaaagc        60
     caggcgcctt ttcagggtcg ttttaaagag aatatctctt atctggaaat aaatcaggaa       120
     tacatggccg gtttaaaaga tattgaaaca gtatctcaca tcatcgtatt gtattggggg       180
     cacttaagtg accgcgaaac actgctggct aaaacccctt ttggtgaaga accgcggggt       240
     gtattttctt gtcgttcccc aaaccgtcct aatccggtag ctgtttgtgt ggcacaatta       300
     ttggaagtaa aggacaatat attgaaagtt aagggcgttg atgcgttgga tcaaagtcct       360
     cttttggaca taaaacctta cagcaataag gtagatatgg ttccagacgc gtgtatagga       420
     tggctggaat cagtacagtc agccaaacaa taa                                    453
//

If you have problems or comments...

PBIL Back to PBIL home page