(data stored in ACNUC7421 zone)

EMBL: CP001720.PE333

CP001720.PE333       Location/Qualifiers
FT   CDS_pept        357622..358485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0345"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: wsu:WS1158 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61298"
FT                   /db_xref="GOA:C8W4U6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C8W4U6"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACV61298.1"
FT                   /translation="MHINYWREVKRDNFGRIGIIIFIVLVLLAVLAPLLTGYRPGTYTG
FT                   SIFKPPSAQYWLGTNDVGQDIWTHLLYGTRTSLTVGCGVALLSAVFSLLIGGTAALFGG
FT                   YYDRIVMRLVDALIVIPPVIIVILAAAYLKPNLFLLILLLSLLIWPGGARIIRAQTLVL
FT                   KDRMHVKAARTFGAGWLHLLSRHIVPDFGPVLIAVMIQDARRAVFMEAGLSFLGISDPA
FT                   MLSWGIMIQHALKFTYLNVWQWWLLPPGFALSLTIMSLTFMGFALEKILDPRLRKQEEG
FT                   EKHVKH"
     atgcacatta actactggcg ggaagtaaaa cgggacaatt ttggccggat aggaattata        60
     atatttattg tgctggtgct gctggctgtt ctggctcctc tgctgaccgg ttaccggcct       120
     ggtacttaca ccggttctat ttttaaacca ccgtcagcgc agtattggct gggaaccaat       180
     gatgtggggc aggatatttg gactcatctt ctttatggca cgcgtacctc actgacggtt       240
     ggctgcgggg tggccttgct gtccgctgtt ttcagtctgc ttattggtgg tacggctgcc       300
     ttgttcggcg gttattatga tcgtattgtg atgcgtttgg tagatgcgct gattgtaata       360
     cctccggtta ttattgtaat tctggcggca gcatatttaa aaccaaacct ttttttgtta       420
     atattattat tatctttgtt aatttggccc ggcggagcca ggataatcag agcccagacg       480
     ctggtcttaa aagatagaat gcacgtaaaa gcagcccgca ctttcggggc cggatggctg       540
     catttattgt cccgtcatat tgtcccggat tttggaccgg ttttgattgc tgttatgatc       600
     caggacgctc gccgggctgt ttttatggaa gcggggcttt cttttttagg tatttccgat       660
     ccggctatgc ttagctgggg tataatgatc cagcatgcct taaaatttac ttatctgaat       720
     gtctggcagt ggtggctctt gcctcccgga tttgctcttt cactgacaat aatgtcctta       780
     acttttatgg gttttgcttt ggaaaaaatc ttggatccac ggctgcgcaa acaagaggag       840
     ggtgaaaagc atgttaagca ttag                                              864
//

If you have problems or comments...

PBIL Back to PBIL home page