(data stored in ACNUC7421 zone)

EMBL: CP001720.PE334

CP001720.PE334       Location/Qualifiers
FT   CDS_pept        358472..360190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0346"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="KEGG: tbd:Tbd_1668 oligopeptidee ABC transporter,
FT                   ATP-binding protein; TIGRFAM: oligopeptide/dipeptide ABC
FT                   transporter, ATPase subunit; PFAM: ABC transporter related;
FT                   Oligopeptide/dipeptide ABC transporter domain protein;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61299"
FT                   /db_xref="GOA:C8W4U7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C8W4U7"
FT                   /inference="protein motif:TFAM:TIGR01727"
FT                   /protein_id="ACV61299.1"
FT                   /translation="MLSISNLKVRFGERYILDGINLEIPPGQILALIGESGAGKTTLGR
FT                   TILRLHDGVIEGNISWNGIELVNLPEEDMRQIRWNSISMVFQNAGEALNPVITVLEQVA
FT                   EPLLVHARLKKKEARAKARLLLAEAGLPLDRVNAYPPQLSGGEKQRAVIAMALANSPEL
FT                   IILDEPTAAMDGLTRREILELLKRTSEHCAMLLVTHDLSAAAALADHTAVLYDGKIIEA
FT                   GATGALLEQPGHPYTRGLLRSYPNMTTTKDMQGIKGKLEHCGSGCRFANRCTQAREICA
FT                   SAEPDLNYYNDRQIACHRGGIVPLLQISNLDCHFGPVKVVDGVNLTVFEGETLALVGQS
FT                   GSGKTTLAATIMGILQPKRGNIVFDEINIGKKRDRSLFKQLQMIFQNPSESISHRATVL
FT                   EAVREPLDIQNIGSCEERIEKVRRVLEEVQLSSDDTFLGKYPHHLSGGEAQRVAIARAM
FT                   ILQPKLIVADEPTSALDASVQAKILKLLLHLQEERGLALLFITHDIALARKVSDRIAVM
FT                   RSGRIIEEGLSSRITSQPQNDYTRELLSAAPSLENSLIFEETGRNNMGYRYRLGM"
     atgttaagca ttagtaacct gaaggtaagg tttggtgaaa gatatatttt ggatgggatt        60
     aatttagaaa ttccgcccgg gcaaatttta gccctcattg gggaatcagg tgccggtaaa       120
     acaacactgg gccggacaat tttaaggctg catgacggtg ttattgaagg aaacattagc       180
     tggaacggta tagaactggt taacttgccg gaggaagata tgcggcaaat aagatggaac       240
     agcatcagta tggtcttcca gaatgccggt gaagctttaa acccggtcat aactgtttta       300
     gagcaggttg cagaaccgct gcttgttcat gcgaggctga aaaaaaagga ggcccgggcc       360
     aaagccaggc tgcttttagc tgaggcgggt ttgccgcttg accgggttaa cgcctatcct       420
     cctcaattaa gcgggggaga aaaacagcgg gcggttatag ccatggcttt agccaacagt       480
     cccgagttaa taatccttga tgaacccact gcggccatgg acggtttaac ccgccgggaa       540
     attcttgaac tgctgaaaag gacatctgag cattgcgcta tgcttttggt tacccatgat       600
     ttatctgctg ccgccgcatt ggctgatcac acggcagttt tatatgacgg caaaattatc       660
     gaagcgggag caaccggtgc attgctggaa caacccggtc atccctatac cagaggcttg       720
     ttgcgttctt atcccaatat gactaccaca aaagatatgc aggggattaa aggcaagctg       780
     gaacactgcg gcagcggctg ccggtttgct aaccgctgta cgcaagccag agaaatttgc       840
     gcttctgcgg agcctgatct aaattattat aatgacaggc agattgcctg tcaccggggc       900
     gggattgtac ctttactgca aataagtaat ttagactgtc attttggtcc ggttaaggtg       960
     gtagacggag taaatttaac ggtttttgaa ggggaaacac tggccctggt agggcagagc      1020
     ggttcgggta aaactactct ggccgcgaca ataatgggca ttttgcaacc aaagcgagga      1080
     aatattgttt ttgatgaaat aaatatcggc aaaaaaagag acagatcact ttttaaacaa      1140
     ttgcagatga tcttccaaaa tccctctgaa tcaatcagtc accgggcaac cgtactggaa      1200
     gctgtcagag aacctttgga tattcaaaat atcggcagct gtgaagaacg aatagagaaa      1260
     gtacgccggg ttttggagga ggtgcaattg tcctcagacg atacctttct gggcaaatac      1320
     ccgcatcatt taagcggcgg tgaggcccag cgggtggcca tagcccgggc catgatttta      1380
     cagcccaagc tgatagtggc cgatgaaccg acctctgcct tggatgccag tgtccaggca      1440
     aagattttaa agctgctgct tcacctgcag gaagagagag gcttagcttt attgtttatt      1500
     acccatgata ttgctctggc ccgtaaagtt agtgacagga tagccgtcat gagatccggg      1560
     agaattattg aggagggtct ctcatccagg attacttctc aacctcaaaa tgattatacc      1620
     agagaattac tgtccgccgc tcccagcctg gagaattcat taattttcga ggagaccggc      1680
     agaaataata tgggatatcg gtaccggtta ggaatgtag                             1719
//

If you have problems or comments...

PBIL Back to PBIL home page