(data stored in ACNUC7421 zone)

EMBL: CP001720.PE335

CP001720.PE335       Location/Qualifiers
FT   CDS_pept        complement(360406..361368)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0347"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related;
FT                   Oligopeptide/dipeptide ABC transporter domain protein;
FT                   SMART: AAA ATPase; KEGG: bha:BH0571 oligopeptide ABC
FT                   transporter ATP- binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61300"
FT                   /db_xref="GOA:C8W4U8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C8W4U8"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACV61300.1"
FT                   /translation="MSLLEINNITKTFSLGNKFLKTNQSIAAVKDISLSLEEGCCLGIV
FT                   GESGCGKTTLGKIILGLEKPERGEVFFLGKDIYQTTGRELKELRRNLQVVFQDSLSAVN
FT                   PRLPIGKIISEPIRNYRKLTPSEEKKQVLELLEIVGLSPADIDKYPHQFSGGQIQRVTI
FT                   ARAIALKPKLIVLDEAVASLDMSVQAQILNLLLDLKEEFKLSYIFISHDILAVNYISDR
FT                   LAVMYMGKVVELIEDIRLIDELRHPYSIKLLSSVLSDHPRHRKKLSSSFDEPAISENGS
FT                   YGCSYFTRCEKASVLCREQTPLLSSLKEKHKVACPYCTR"
     atgagcttgc ttgagataaa taatattacc aaaaccttca gtctcggcaa caagttcttg        60
     aaaaccaatc aaagcattgc cgcggtaaag gatatttcct taagcctgga agaaggttgt       120
     tgtcttggta tcgtgggtga aagcggttgt ggtaaaacta cactgggtaa aataatactc       180
     ggtttggaaa agcctgaacg gggcgaagtt ttctttctgg gcaaagacat ctaccaaaca       240
     accggccggg aacttaagga actgcgccgc aacttgcagg tggtttttca agacagcttg       300
     agtgcagtta atcccaggct gccaattggc aaaataatca gtgagcctat cagaaactac       360
     cggaaactga ccccttcgga agaaaaaaaa caggtactag agcttttgga aattgtaggc       420
     ttaagtcctg ctgatataga caaatatcct caccagttca gcggtggcca aatacagagg       480
     gtaactatag ccagagcaat cgcattaaaa ccaaaattaa ttgtgctgga tgaagcggta       540
     gccagtttgg atatgtcggt tcaagcacag attttaaacc ttttactgga tttaaaagaa       600
     gaattcaagc tttcctatat atttatttcg catgatatat tagcagtaaa ttatatatct       660
     gacagactgg cagtgatgta tatgggcaaa gttgtcgagt taatcgaaga tataagatta       720
     atagatgaat tgcggcaccc ttatagtatc aaattattgt cctctgtgtt atcagatcac       780
     ccacgtcaca gaaagaaatt gagttcaagt tttgatgagc cggctattag cgaaaacggc       840
     agctatggct gcagctattt taccaggtgt gagaaagcca gcgtcctttg ccgtgaacaa       900
     acaccattac taagttcctt aaaagaaaaa cataaagtag cctgcccata ctgcactcgt       960
     taa                                                                     963
//

If you have problems or comments...

PBIL Back to PBIL home page