(data stored in ACNUC7421 zone)

EMBL: CP001720.PE336

CP001720.PE336       Location/Qualifiers
FT   CDS_pept        complement(361355..362350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0348"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="KEGG: reh:H16_B1125 ABC-type transporter, ATPase
FT                   component: PepT family; TIGRFAM: oligopeptide/dipeptide ABC
FT                   transporter, ATPase subunit; PFAM: ABC transporter related;
FT                   Oligopeptide/dipeptide ABC transporter domain protein;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61301"
FT                   /db_xref="GOA:C8W4U9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C8W4U9"
FT                   /inference="protein motif:TFAM:TIGR01727"
FT                   /protein_id="ACV61301.1"
FT                   /translation="MTLQPVLSVENLHAHIPTAAGTIRAVNGISFRIWPGKVLGLMGES
FT                   GCGKSITCLSVLGLLNGAGKIIKGKIRLKDRDILSLPTEELRKLRGNEISMIMQNPMSS
FT                   FDPIVSIGQQFIETIRNHKKVTKREAITTALECLRQVELPCPEDLFNRYPFQMSGGMLQ
FT                   RVMIAIAIASNPAVLIADEPTTALDVTVQQRILGQLVKVQEKYNTGILLVSHDLKVIAQ
FT                   MADEVAVMYCGYIVEKGPAMKIFDHPLHPYTRALLASRPGLQKARLKPIKGQPPALIDL
FT                   KDICPFFERCDEANKACLEYKVYLTRYAPDHFVSCLKYASNQEVVLYELA"
     atgactttac agcctgtttt atctgtagaa aatttacatg cacatatacc tactgctgca        60
     gggacgatca gagcagtaaa cggtatcagt ttccggatct ggcccggtaa agtgctgggc       120
     ttgatgggag aaagcggttg tggaaaaagc attacttgtt tatctgtttt aggcctttta       180
     aacggtgcgg ggaaaattat caagggaaaa ataagactta aggataggga tattttgagt       240
     ttgccaactg aggaattaag aaaattacgg ggaaacgaaa tcagcatgat tatgcaaaat       300
     ccaatgagca gcttcgatcc catagtatct attggtcagc agtttattga aacaatcaga       360
     aaccataaaa aagtaacaaa gagggaagcc ataactacgg cgcttgaatg tttacggcag       420
     gtagaactgc cttgccccga agacttattc aaccgttatc cttttcaaat gagcggcgga       480
     atgctccaga gagtaatgat tgccatagcc attgcttcaa atccagcagt cttaattgcc       540
     gacgaaccta ccactgctct ggacgtcaca gtgcagcagc ggatactggg tcaattggtg       600
     aaagttcagg agaagtataa tacgggaata ttgttggttt ctcatgattt gaaagtgatt       660
     gcccaaatgg cagatgaagt agcagttatg tactgtggat atattgttga aaaaggacct       720
     gctatgaaaa tatttgatca tcctctgcac ccttacaccc gtgcactgct ggcttcaagg       780
     ccgggtttgc aaaaagccag gctaaaaccc attaagggtc aaccgccggc cttaatagat       840
     ttaaaagaca tatgcccttt tttcgaaaga tgcgatgaag caaataaagc ttgtttggaa       900
     tataaggtat atttaacacg gtatgccccg gatcattttg taagctgcct taaatatgct       960
     tcaaatcaag aggtagtgct atatgagctt gcttga                                 996
//

If you have problems or comments...

PBIL Back to PBIL home page