(data stored in ACNUC7421 zone)

EMBL: CP001720.PE338

CP001720.PE338       Location/Qualifiers
FT   CDS_pept        complement(363208..364140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0350"
FT                   /product="nickel ABC transporter, permease subunit NikB"
FT                   /note="TIGRFAM: nickel ABC transporter, permease subunit
FT                   NikB; PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: avi:Avi_7614 nickel ABC
FT                   transporter permease subunit NikB"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61303"
FT                   /db_xref="GOA:C8W4V1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR014156"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C8W4V1"
FT                   /inference="protein motif:TFAM:TIGR02789"
FT                   /protein_id="ACV61303.1"
FT                   /translation="MKKYIFRRLLNIIPVLLGISVITFGLIHMVPCDPAEVYLRLSQIP
FT                   PTDEAVALVRSELGLDRPLYIQYFDWLWKVFHLDFGKSFVTRQPVLPSVLYYIPATIQL
FT                   TACSLLLMFLISIPLGIWAALYKDSLLDQFSRILAFIGASMPSFWLGFLLLYVFSLKLD
FT                   LLPVTGRGTFLHLILPSLTLALGYAATYTRLLRTSMLENLNKDFVLYARVRGIKEKLII
FT                   GKHVFKNALLPMITAFGMSLGHLLAGSVIVENIFAWPGVGRYCVFSIFSRDYPVIQCYV
FT                   CLMAVIFVVCNLLVDIAYVYLDPRIKIGR"
     gtgaaaaagt atattttcag acgattactc aacataatac cggtgctgct gggtatatct        60
     gtaataacct tcggcttaat tcatatggta ccctgtgatc cggcagaagt ctacctgagg       120
     ctgtcacaaa ttcctcccac agatgaagct gttgctctgg taagatccga attaggactg       180
     gacagaccat tatatattca gtattttgac tggctgtgga aagtgtttca tcttgatttc       240
     ggcaaatcct tcgtgacaag acaacctgtt ttgccgtccg tattatatta cattccagct       300
     acaatacaac taaccgcttg ttctttactc ctcatgttct taataagtat acccctcggc       360
     atttgggctg ctttatacaa ggacagcttg cttgaccagt ttagcaggat attggcattt       420
     ataggcgcat ctatgccaag cttctggctg ggattcctgc tgctgtatgt tttttcttta       480
     aagcttgatt tgctgccggt tacaggaaga ggaactttct tgcatcttat tttaccatcc       540
     ttaactctgg cactgggata tgcggctaca tataccaggc tcttgaggac aagtatgttg       600
     gagaacttaa ataaagattt tgtattgtac gccagagtca gaggaattaa agagaagctc       660
     attatcggta agcatgtttt taaaaatgca ctgctgccaa tgataactgc tttcggaatg       720
     agtctggggc atttactggc aggctctgtc atagtggaaa atatttttgc ctggccgggt       780
     gttggcaggt actgtgtttt ttccatattc agcagggatt acccggttat tcagtgctat       840
     gtttgtttaa tggctgtaat atttgttgtc tgcaatctcc tggttgatat tgcctacgta       900
     tatttagatc cgcgcatcaa aataggaagg taa                                    933
//

If you have problems or comments...

PBIL Back to PBIL home page