(data stored in ACNUC7421 zone)

EMBL: CP001720.PE339

CP001720.PE339       Location/Qualifiers
FT   CDS_pept        complement(364217..365815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0351"
FT                   /product="nickel ABC transporter, periplasmic
FT                   nickel-binding protein"
FT                   /note="TIGRFAM: nickel ABC transporter, periplasmic nickel-
FT                   binding protein; PFAM: extracellular solute-binding protein
FT                   family 5; KEGG: dvm:DvMF_2402 nickel ABC transporter,
FT                   periplasmic nickel-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61304"
FT                   /db_xref="GOA:C8W4V2"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR011980"
FT                   /db_xref="InterPro:IPR023765"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:C8W4V2"
FT                   /inference="protein motif:TFAM:TIGR02294"
FT                   /protein_id="ACV61304.1"
FT                   /translation="MKKLIYLALLLIIVYSVSLTGCGNSTEKTTGVKTKAKELTFSWNK
FT                   DIGDLNPHNYSAQMFAQGLVYEPLVTYAEGGKIEPCLAEKWDTSPDGREITFTLRKGVN
FT                   FSDGTEFNAAAAKQNFDAVLANAQRHEWLELINQIEKTEVSGDYTLKVYFKNAYYPALQ
FT                   EFALIRPIRFLAPTGFPENGQTSEAIKKPIGTGPWVLSEYKKDEYAVFTRNENYWGTKP
FT                   KLEKVIVKIIPDGETRVIAFEKGELDLIFGSGVISLDSFKQLKESGKYETKNSGPLSTR
FT                   VIAMNSNKGATKDLPVRQAIQHGINKQAVINGIFYGTEEKADTLFSSNLPYCDLKLKPY
FT                   DYNLEKAASLLDNAGWKQADGKEFREKNGQALELELCFDSTDNIQKSAAEAMQGDLKKL
FT                   GINLKLIAEESQAYNQRQKDGNFNLIFSETWGVPYDPHSLCSSMRKPSHADYQAQSGLS
FT                   MKPEIDKKIEEVLLSTDEKTRQELYTYILKTLHEQAVYLPISYRTNMAVYHKNLSGFKF
FT                   LSTQYDVPLTDIDIK"
     atgaaaaaat taatatattt agcgttatta ctaataatag tatattctgt atccctcacc        60
     ggttgcggca acagtacaga aaaaactact ggtgtaaaaa caaaagctaa ggaactcact       120
     ttttcctgga ataaagatat cggggatttg aacccgcata attattcagc tcagatgttt       180
     gctcagggtc tggtctacga accgctggta acctacgctg aaggcggtaa aattgagcct       240
     tgtctggcgg aaaagtggga tacatctccc gacggcaggg aaataacttt taccctgcgt       300
     aaaggtgtaa atttctccga tggcactgag tttaacgctg cggcggcaaa acaaaacttt       360
     gatgcagtac tggctaatgc ccaaaggcat gaatggttgg aattaattaa tcaaatcgaa       420
     aaaactgagg tatccggtga ctatacctta aaagtttatt ttaaaaatgc ctattacccg       480
     gcgctgcagg aatttgctct gattaggccg ataagattcc tagctcccac gggctttcct       540
     gagaatggac aaaccagcga agccattaaa aaacccattg gtacaggccc gtgggtgttg       600
     agtgagtaca aaaaagatga atatgctgta ttcacaagga atgaaaatta ttgggggacc       660
     aaacccaagc tagaaaaagt tattgttaaa attattcctg atggtgaaac cagagtaatt       720
     gcctttgaga agggcgaact ggatttaatc tttggcagcg gtgttataag tctggattcc       780
     tttaaacagc tcaaagaatc cggcaaatat gagactaaaa actccggtcc tctttcaacg       840
     agagttatag ctatgaattc caacaaagga gccaccaagg atttgccggt tcgccaggct       900
     attcagcatg gcattaataa acaggctgta atcaacggaa tattttacgg cacggaagaa       960
     aaagctgata cacttttttc atcaaatctg ccttattgcg atttaaaatt aaaaccctat      1020
     gattataatc ttgaaaaggc tgcctcacta ttggataatg ccggttggaa acaggcagac      1080
     ggaaaagaat tcagagaaaa aaacgggcaa gcattggaac tggaattatg ttttgacagc      1140
     actgataata tccaaaagtc tgctgcagag gctatgcaag gtgatctgaa aaagctcggc      1200
     atcaatctaa aactaattgc cgaagaaagt caagcctata accaaaggca aaaagacggc      1260
     aactttaacc ttattttcag cgagacctgg ggcgttccct acgatccaca ttcattgtgt      1320
     tcttccatga gaaaaccttc ccatgccgat tatcaggctc agtcaggtct ctccatgaag      1380
     cctgaaatcg ataaaaaaat agaagaggtt ctattaagca ctgatgaaaa gacgagacag      1440
     gagctttata cttatattct gaaaacgtta catgagcagg ctgtttatct tcccatttct      1500
     tacaggacca atatggctgt ttaccataag aatcttagcg gttttaaatt cttatcaact      1560
     cagtatgatg taccattaac tgatattgac atcaagtaa                             1599
//

If you have problems or comments...

PBIL Back to PBIL home page