(data stored in ACNUC7421 zone)

EMBL: CP001720.PE340

CP001720.PE340       Location/Qualifiers
FT   CDS_pept        366511..367260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0352"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; UbiE/COQ5
FT                   methyltransferase; Methyltransferase type 12; KEGG:
FT                   msu:MS0467 SmtA protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61305"
FT                   /db_xref="GOA:C8W4V3"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C8W4V3"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ACV61305.1"
FT                   /translation="MQIQQRIENYWQGAASRYSNNIWKEMNSFKKDAWAALIDEHRSAG
FT                   ESLKVLDIGTGPGFFAMLLSGMGHTVTAIDCTENMLVEAGYNVQKVGFHVQFYKMDSHV
FT                   LDFPEGTFDLIVCRNLTWTLRDPVQAYREWHRVLKPGGKLMVFDANWHLRLFDPEMDRL
FT                   YREDKERARQMGIPDSHDQSNMEESDKIARQLYLSSRRRPDWDESALLEAGFCKLIIDE
FT                   DISGKVWDAHDRVLYRSTPMFMLVAEK"
     atgcagattc agcagcgtat tgaaaactac tggcaggggg ctgcttctcg ttacagcaac        60
     aacatttgga aggaaatgaa tagctttaaa aaagacgcct gggcagcttt gattgatgaa       120
     catcgatcag cgggtgagtc tctaaaagtc ttggatatcg gtaccggacc aggctttttt       180
     gccatgctac tgtccggtat gggccatact gtaaccgcca tcgactgtac cgaaaatatg       240
     ctggtagaag caggatacaa tgtccaaaag gttggttttc atgtgcaatt ttataaaatg       300
     gattctcatg tactggattt tcccgagggt acttttgatt taattgtatg caggaatctg       360
     acctggacct tgagggatcc ggttcaagct tatcgtgagt ggcaccgggt gttaaagcct       420
     ggtgggaagc ttatggtatt tgatgccaat tggcatttga gactgtttga tccggaaatg       480
     gacagacttt accgggagga taaggaaaga gccaggcaaa tgggtatacc ggatagccat       540
     gatcagagca acatggagga aagtgataaa atagcccgtc aactctatct cagcagccgc       600
     cggcgccccg attgggacga gtcagcattg ctggaagcag gcttttgcaa acttattatt       660
     gacgaggata tcagcggcaa agtatgggat gcgcacgaca gggtgctgta caggtcaaca       720
     cctatgttca tgcttgtggc cgaaaagtaa                                        750
//

If you have problems or comments...

PBIL Back to PBIL home page