(data stored in ACNUC7421 zone)

EMBL: CP001720.PE341

CP001720.PE341       Location/Qualifiers
FT   CDS_pept        367315..369042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0353"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bur:Bcep18194_B1962 ABC efflux pump, fused ATPase and
FT                   inner membrane subunits"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61306"
FT                   /db_xref="GOA:C8W4V4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:C8W4V4"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACV61306.1"
FT                   /translation="MNFYLRIFSLLKGSYLHIACKIAMGVLITATYVGQAFAIAAGLKG
FT                   VFYKKSLEDLGFVLLCIGLLVLLRALLHWLDEIYAKRIAFWVKSRLRERLFQHVMNLGP
FT                   GYQENCRSGSIQALLTDGVESLEPLLTGYIPQLLVAFFGSGLISLYIFSLDRVVGIIAL
FT                   TGIIITVLFPQLMSKYVGKIILEYWQSHARLNSQYIDAMQGMAALKMFNAGKKKGQELS
FT                   EEAWGHYRHSMQGLGISLLDSAVVKWAAAAGSTLAAGVGALRVSNGELPLADLFIILFL
FT                   SVECFRPLNELVMYWHRSFLGIAAVRGIFAIFDTNISIQDQEDFNGDNNVCPYPEIDFK
FT                   NVTFSYAAGKRPAVKNVSLRVNPGETVAIVGKSGSGKSTMVNLLLRFFEQQEGSILLNG
FT                   RDIKDYPLSFLRSQIAVVFQDTYLFYGTVEDNLKIAKPGATREELEQAAKLANAHDFIM
FT                   NLKDGYRTHIGERGVRLSGGQKQRLSIARAVLKNAPLLILDEATSNVDGASEKMIQEAL
FT                   DKLVRNRTTIIIAHRLSTIKGADRIIVLDDHRVKETGTHSELLGFGGIYAQLVRLQQG"
     atgaatttct atttgagaat tttttctctg ctcaagggct cctatcttca cattgcctgc        60
     aaaattgcca tgggggtgct tattaccgct acctatgtgg ggcaggcgtt tgccatagcc       120
     gccggtctaa aaggcgtgtt ttataaaaaa agcctggagg acctgggatt tgttctttta       180
     tgtatcggtt tgttggtgct tttgcgggcg ttgcttcact ggttggacga gatttatgcc       240
     aaaaggatag ccttttgggt gaaaagcaga ctcagggagc ggttgttcca gcacgttatg       300
     aacctgggac caggttatca ggaaaactgc cgcagcggca gcattcaggc gttgctcaca       360
     gacggggtgg agtctctgga accgttgctg actggctata tcccccaact tttggtggct       420
     tttttcggtt ccggtcttat atcgttatat attttcagtc tggatcgagt ggtaggaatt       480
     atcgcgttaa ccggcattat cataacggtg ttatttcccc agttgatgag caaatatgtc       540
     gggaaaatca tattggaata ctggcagtcg cacgcccggc tgaattccca atatattgat       600
     gccatgcagg gtatggctgc cttgaagatg tttaatgcag ggaagaaaaa gggccaggaa       660
     ctgagcgagg aggcctgggg acactatcgt cattccatgc agggccttgg tatttctttg       720
     ctggattcag ctgtggtcaa atgggccgcc gccgccggtt caacgctggc tgccggtgtt       780
     ggggcactga gggtgagtaa tggcgagctg cctctggctg atctattcat catacttttt       840
     ctgtcagttg agtgtttcag acctttaaat gaattagtca tgtactggca caggagtttt       900
     ctgggtattg ctgcggtcag gggtatattt gctatttttg ataccaatat aagcattcag       960
     gatcaagagg attttaacgg ggataataat gtttgccctt acccggagat agacttcaaa      1020
     aatgtcacct tttcatatgc agcagggaaa aggccggcgg tgaaaaatgt gtcactgcgg      1080
     gttaatccag gtgaaacagt tgccatagtg ggtaaatccg gttccggcaa gtctaccatg      1140
     gtgaacctgc tattgcgatt ttttgagcag caggaaggca gtatactgct taatggtcgg      1200
     gatatcaagg attacccatt gtcttttttg cgcagtcaga tagccgtggt ttttcaggat      1260
     acctatcttt tttacggtac tgttgaggat aacttaaaaa tagctaaacc aggcgcaacc      1320
     agggaggaat tggagcaagc ggctaagctg gcaaatgccc atgatttcat aatgaatcta      1380
     aaagatggtt accgaacaca tataggggag cgaggggttc gtttgtccgg ggggcagaag      1440
     caaagattgt caattgccag ggctgtatta aaaaatgccc cactcttgat cctggatgag      1500
     gcaacttcta atgtagacgg ggcaagtgaa aaaatgattc aggaagcttt agacaaactg      1560
     gttcgtaaca gaactacaat tattattgct cacaggttgt ccactattaa gggagctgac      1620
     cgcatcattg tattggatga ccatagggtg aaagagaccg gtacccacag tgaactgctt      1680
     ggtttcgggg gaatttatgc gcaactggtt aggttgcagc aaggctga                   1728
//

If you have problems or comments...

PBIL Back to PBIL home page