(data stored in ACNUC7421 zone)

EMBL: CP001720.PE342

CP001720.PE342       Location/Qualifiers
FT   CDS_pept        369057..370814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0354"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; ABC transporter
FT                   transmembrane region; SMART: AAA ATPase; KEGG:
FT                   bch:Bcen2424_4081 ABC transporter, transmembrane region,
FT                   type 1"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61307"
FT                   /db_xref="GOA:C8W4V5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:C8W4V5"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACV61307.1"
FT                   /translation="MNTILAKLNLTGFARLLLYLRPYWKGMAIAISSGTLHHLFAIAGA
FT                   TLAAYLVGLTAMGGGKEQILSLLPALVLLISLRVVMYFSDMWFAHEVAFRILVEFRIKI
FT                   YQSVERVSPAYLLNRRSGELASTLMADIEVLEWFFAHTAGTFLVALLVSLITLGLLGCI
FT                   NWLLPLVVTPWIILLFSVPFWFSRKADRQGKDTREKLADINCEAVDGVQGLREIISFNY
FT                   ERGFLDRLRLYSDRLGQSLYFYGRRLGFEGALLNIFSSLTIICVLGVSAYLIVSGQMDF
FT                   SWLPVTVILSANMLTPVLEISSMARNFGIILAAAERVYTVLEAKETVQDGAVSLPEGTI
FT                   KPQICFNNVSFRYREDLPNVLNDISFSVGEGETVALVGHSGVGKTTCINLLQRFWDVNR
FT                   GQIAFGSMAIKELPLDYLRSLITMVPQDIYLFNTSILENIKLGKQGASREEVKAAAKAA
FT                   YIHDFIAGLPEGYDTIAGERGVKMSGGQKQRIAIARAMLKNSPILILDEALSSLDTENE
FT                   RLLQESIKNLRRGRTTLIVAHRLSTFRDADKLVVLKNGKVIEIGSHAELMEKRGYYGEF
FT                   VSSQVAVSG"
     ttgaatacta tactggcaaa actaaatctc acaggttttg caaggctgct tctatatctc        60
     cgtccttatt ggaaagggat ggctatagcc ataagcagcg gcaccctgca tcatttattt       120
     gccatagccg gcgctaccct agctgcctat ctggtggggc taactgccat gggagggggg       180
     aaggagcaga ttttgtcact tttgcccgcg ctggttttac tcattagcct gcgagtggta       240
     atgtattttt cagatatgtg gtttgcccat gaggttgctt ttcggatttt ggtggagttc       300
     aggattaaga tatatcagtc ggtggagcgg gtgtccccgg cctatctgtt gaaccggcgt       360
     tccggcgagc tggcgtccac actcatggct gatattgaag tattggagtg gtttttcgcc       420
     cacactgcgg ggacttttct ggtggcgctg ttggtttccc tgatcacctt aggcttactg       480
     gggtgcatca attggttgct tcctctagta gtcactccct ggattattct attgttcagc       540
     gtaccttttt ggttcagccg gaaagctgac cggcagggta aggacaccag agaaaagctg       600
     gccgatatta attgcgaggc agtggacgga gtgcaggggc tgcgggagat tatctctttc       660
     aactatgagc ggggtttttt agacagatta aggctctact cggatcggtt ggggcaaagt       720
     ctgtacttct acggcaggag actgggtttt gagggggcgt tgctaaatat tttttcctcc       780
     cttacaatta tttgtgtttt gggggtttcc gcttatctga ttgtcagcgg tcagatggat       840
     tttagctggc tccctgtgac cgtaatactg tctgccaata tgctcacccc tgtcctggag       900
     atatcgtcca tggccagaaa tttcgggatt atactggcgg cagcggagag ggtatatacg       960
     gtgcttgagg ccaaagaaac agtgcaggac ggagcagtta gtttgcccga aggcaccata      1020
     aagcctcaaa tatgtttcaa caatgtgtcg tttcgctaca gggaagacct gcctaacgtg      1080
     cttaatgata taagtttttc tgtgggagaa ggggaaacgg tagctctggt gggccattca      1140
     ggggtaggca agactacatg tatcaatttg ctgcaaaggt tctgggatgt gaacaggggg      1200
     cagattgcat ttggaagtat ggcaataaag gaattgcctt tggattacct gcgcagtttg      1260
     attactatgg tgcctcaaga tatttatctt ttcaacacct ctattctgga aaatataaag      1320
     ttgggcaagc agggggcttc cagggaagaa gtcaaggcgg ctgccaaggc tgcttacata      1380
     catgatttta tagccggttt gccggagggt tacgatacaa ttgccgggga gaggggagta      1440
     aagatgtccg ggggccagaa gcagagaatc gctattgcca gagcaatgct gaagaattct      1500
     cctatattga ttttggacga agcactttca agcctggaca cggaaaacga aagattatta      1560
     caggaatcaa tcaaaaattt gcgccgggga cgaaccaccc ttatcgtagc ccacaggctt      1620
     tccacctttc gtgacgctga caagttagtg gttttaaaaa atggtaaagt aattgaaatc      1680
     ggcagtcacg cggagcttat ggaaaaaaga ggatactatg gtgaatttgt ctcttctcaa      1740
     gttgctgttt ccggataa                                                    1758
//

If you have problems or comments...

PBIL Back to PBIL home page