(data stored in ACNUC7421 zone)

EMBL: CP001720.PE348

CP001720.PE348       Location/Qualifiers
FT   CDS_pept        377281..377883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0361"
FT                   /product="flavin reductase domain protein FMN-binding"
FT                   /note="PFAM: flavin reductase domain protein FMN-binding;
FT                   KEGG: pha:PSHAa2199 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61313"
FT                   /db_xref="GOA:C8W4W1"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:C8W4W1"
FT                   /inference="protein motif:PFAM:PF01613"
FT                   /protein_id="ACV61313.1"
FT                   /translation="MILKPRQREQVLPLPVALISTVSQEGIRNIAPWSNITPILRPFDE
FT                   IVMASWIKRDTLNNIRQTKEFVINIPHEEMVEQVILCSKNYPPEVDEFEVANLAARSSQ
FT                   IIKPPGIEGCLAWMECTLVEEISRKNYSLVIGKVVHLEVDDRFFNENGDMDFEQAKPLS
FT                   IILGDKGMWFTSSFYAGRYADYAEMFLGKKDETPVLT"
     atgattttaa agccgcgcca aagggaacag gttttaccgc tgccggtagc tcttatttct        60
     accgtgtcac aggaaggtat cagaaatatt gctccatggt ctaacatcac accgatattg       120
     cgccctttcg acgaaattgt tatggcttca tggattaagc gcgatacgct gaataatatc       180
     cggcagacaa aagaatttgt tattaatatc ccacatgagg aaatggtaga gcaagtaatt       240
     ctctgctcaa agaattaccc cccggaggtt gatgagtttg aggttgctaa tcttgcagcg       300
     cgatcttctc agataataaa acctcccggg attgagggtt gtctggcctg gatggagtgt       360
     accctggtag aggagattag caggaagaat tattctctgg taattggcaa agttgttcat       420
     ttagaggtag atgaccgttt ctttaatgaa aacggagata tggattttga acaggcgaag       480
     ccactgtcta ttatacttgg cgataaagga atgtggttta cctcctcctt ttatgccggc       540
     agatatgctg attatgcgga aatgtttttg ggcaagaaag acgaaactcc tgtattaacc       600
     taa                                                                     603
//

If you have problems or comments...

PBIL Back to PBIL home page