(data stored in ACNUC7421 zone)

EMBL: CP001720.PE35

CP001720.PE35        Location/Qualifiers
FT   CDS_pept        37341..38129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0036"
FT                   /product="protein of unknown function DUF45"
FT                   /note="PFAM: protein of unknown function DUF45; KEGG:
FT                   avi:Avi_0018 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61000"
FT                   /db_xref="InterPro:IPR002725"
FT                   /db_xref="UniProtKB/TrEMBL:C8VVC6"
FT                   /inference="protein motif:PFAM:PF01863"
FT                   /protein_id="ACV61000.1"
FT                   /translation="MENFSAQTDSDQNSAIQEYSVMLAGRKLEFILRVSSRAKYLRLQV
FT                   SAKNGLLVTIPKGYKLKYLEEFIREKRDWIFEKLDKFAQELENSKICEQNKCRHILFAG
FT                   KEYELTTRVEMREKPDVLLENGRMIVLIPEEDSQFFKVGNYLREWLFLQARLLINSRVK
FT                   LLSNKLNLTYKNVFIKDQKTRWGSCSQQKNLNFNWRLVMAPLEVLDYVVIHELMHLLEL
FT                   NHSKKFWYLVKSVCPDCRAHREWLRNNGKFLMCEFGSIKF"
     atggaaaatt tttccgcaca aactgattca gatcagaatt cagctataca agagtattcg        60
     gttatgcttg cggggaggaa gctggagttt attttaagag ttagtagcag ggcaaaatat       120
     ttacgcttgc aggtgagtgc caaaaacggt ttgctggtta caattccaaa gggatataaa       180
     ttaaaatatc tggaagaatt tatccgtgag aagcgggact ggatttttga aaaactagat       240
     aaatttgcac aggaacttga aaacagtaag atatgtgaac aaaacaaatg ccgtcatatt       300
     ttatttgcag ggaaagagta tgagttgaca acaagagtgg agatgcggga aaaaccggat       360
     gtattattgg aaaacggaag aatgattgtt cttatacccg aggaagacag tcagtttttt       420
     aaagtaggta attacttgag agagtggctt tttctgcagg cccgtttgct tataaacagc       480
     cgtgtaaaac tattaagcaa taaattgaat ctaacttata aaaatgtttt tataaaggac       540
     cagaagacac gctggggtag ttgctcgcag caaaaaaacc taaactttaa ctggcggttg       600
     gtaatggctc cgcttgaagt attggattat gttgttatac atgagttaat gcatttgtta       660
     gaactgaacc attcaaaaaa attctggtat ttagtgaaaa gtgtgtgccc tgattgcagg       720
     gcacacaggg aatggctgag aaataacggt aagtttttaa tgtgcgagtt tggttctatt       780
     aaattttaa                                                               789
//

If you have problems or comments...

PBIL Back to PBIL home page