(data stored in ACNUC7421 zone)

EMBL: CP001720.PE352

CP001720.PE352       Location/Qualifiers
FT   CDS_pept        383530..383820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0368"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bha:BH3910 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61317"
FT                   /db_xref="UniProtKB/TrEMBL:C8W4W5"
FT                   /inference="similar to AA sequence:KEGG:BH3910"
FT                   /protein_id="ACV61317.1"
FT                   /translation="MWKLINKKIIFLFIIIVIILLQFSVIQKAVARLSTTLYVCIKYSD
FT                   RDIQYQYIEYVPQFGDYFVAYEDKNGESISFMVTPKIFPILILYDPLNRPM"
     atgtggaaat taattaataa aaaaattatc tttttgttta tcatcatagt aatcattcta        60
     ttacagtttt ctgttataca aaaagcggta gcgagattat ctacaacact ttacgtatgt       120
     atcaagtata gtgatagaga tattcaatat caatatattg aatatgtacc tcaatttgga       180
     gattattttg ttgcatatga agataaaaac ggagagagca ttagttttat ggttacacca       240
     aaaatctttc caattcttat attatacgat cctcttaatc gaccaatgta g                291
//

If you have problems or comments...

PBIL Back to PBIL home page