(data stored in ACNUC7421 zone)

EMBL: CP001720.PE353

CP001720.PE353       Location/Qualifiers
FT   CDS_pept        383889..384839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0369"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bha:BH0568 nickel transport
FT                   system (permease)"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61318"
FT                   /db_xref="GOA:C8W4W6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C8W4W6"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACV61318.1"
FT                   /translation="MILYLLKRLFYLIPVMFGVSIITFALINLAPGDPAEILLRSSGVE
FT                   PTLEAVEAMREEFGLNNSVYMQYFHWLVKVLQLDLGNSFRTGQPVALEVLSRFPATLEL
FT                   TLAALFFMLLLAVPSGICAALYKNAWIDHFSRLVALFGASMPAFWLGLLLIYILAVKLH
FT                   LFPVMGRGGWSHLVLPSATLGFGLAATYTRLLRSSMLDVLGQDFIKVARAKGLQEKLII
FT                   SRHAMRNALLPVVTVFGMSFGHLLGGTAIVETIFAWPGVGRLCVDSIFNRDYPVIQAYV
FT                   LLMALVFVLVNLIVDISYVFLDPRIRLGKGDRYER"
     atgatactat atttattaaa acgtttattt taccttatac cggtaatgtt tggtgtctct        60
     attataactt ttgctttgat taatcttgca ccgggagatc ctgcagaaat ccttttgcgg       120
     agcagcggag tggaaccgac actcgaagcg gttgaggcaa tgagagaaga atttggcctg       180
     aataatagtg tttatatgca gtattttcat tggttggtta aagtgctgca gcttgatttg       240
     ggcaattcct ttcgtacggg tcaacctgtg gcgctggaag tgttaagccg ttttccggca       300
     actcttgagt taactctggc cgctttgttt ttcatgcttt tattggcggt acctagcggg       360
     atctgtgctg ctttatataa aaacgcctgg atagatcatt ttagtcgctt ggtagcctta       420
     ttcggtgcat ctatgcctgc gttttggctg ggtttgttgt tgatctatat tctggcggtt       480
     aaactgcacc tttttcctgt aatggggcgg ggtgggtgga gtcatctggt gctgccgtct       540
     gcaactcttg ggtttggtct ggcggccact tatacccgtc tgttgaggag cagtatgttg       600
     gatgttctgg ggcaggattt tattaaggtg gctcgagcca aggggctgca agagaagctg       660
     atcatttcac ggcatgccat gagaaatgcc ctcttacctg tggtaactgt ttttggcatg       720
     agttttgggc atctgttggg aggcacggcc attgtggaaa caattttcgc ctggccggga       780
     gtcggaagat tatgtgtaga ctctattttt aatcgtgact atccggtgat tcaggcctat       840
     gtgctgttga tggccttagt gtttgttttg gttaacctaa tagtagatat atcttatgtt       900
     tttctggatc cacggattcg tttgggaaag ggagaccggt atgagcggta a                951
//

If you have problems or comments...

PBIL Back to PBIL home page