(data stored in ACNUC7421 zone)

EMBL: CP001720.PE354

CP001720.PE354       Location/Qualifiers
FT   CDS_pept        384829..385683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0370"
FT                   /product="nickel ABC transporter, permease subunit NikC"
FT                   /note="TIGRFAM: nickel ABC transporter, permease subunit
FT                   NikC; PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bha:BH0569 nickel transport
FT                   system (permease)"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61319"
FT                   /db_xref="GOA:C8W4W7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR014157"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C8W4W7"
FT                   /inference="protein motif:TFAM:TIGR02790"
FT                   /protein_id="ACV61319.1"
FT                   /translation="MSGKGLLGATLARLLKDRLALIGLGIIMLVFFTGVFAPFITPHDP
FT                   DEVKLEQILLPVTADYPLGTDHLGRCVLSRLIFGTRVSVSTSLLVLITIMLIGIPIGTL
FT                   SGYYGGRIDNFIMRIIDVLLAFPGLILTLVIAGMLGPNLINVMIALSAVWWVGYARVVR
FT                   GMVLSIKEKEYVLGARAAGTSNINILVRHIIPNVLSPVIVMATLDMGKLILAISSLSFL
FT                   GLGAQPPTPEWGAMLNDGKNYMQVAPNLMLFPGIAIMVLVLAFNLLGDGLRDAFDPRSS
FT                   TER"
     atgagcggta aaggtttgtt gggagcgact ctggcaaggc ttcttaaaga taggcttgct        60
     ttaattgggt taggcataat catgctcgtt ttttttacag gggtatttgc gccttttata       120
     acgccacatg atccggatga agttaaactc gaacaaatat tattgcctgt tactgccgat       180
     tatcctttag gtaccgatca tttgggccgc tgcgtacttt cccgcttaat atttggaacc       240
     agagtgtcag tcagcacgtc actgctggtt ttaataacaa ttatgctaat cggtattcct       300
     ataggaacgc tttcaggata ctacggggga agaatagata attttatcat gcgtattatt       360
     gatgtgctgc tggcttttcc cggccttatt ttgactctgg ttattgccgg tatgttgggg       420
     ccaaacctta tcaatgtgat gattgcttta tctgcggtat ggtgggtagg ttatgcacgg       480
     gttgtcagag gtatggtttt gtcgataaaa gaaaaagaat atgttttggg tgccagagca       540
     gccggtacat caaatataaa tattttagtc cgtcacatta tacccaatgt attatctcct       600
     gtgatagtaa tggccacttt ggatatgggg aagctgattt tagccatttc cagtctgtct       660
     tttctgggtt taggggctca accgcccacg cctgagtggg gggctatgct taatgacgga       720
     aagaattata tgcaggtggc accgaattta atgctttttc ccgggatagc aataatggtg       780
     ttggtactgg ctttcaatct cttgggagat ggtctgcgag acgcttttga tcccagaagt       840
     tcgactgaaa ggtag                                                        855
//

If you have problems or comments...

PBIL Back to PBIL home page