(data stored in ACNUC7421 zone)

EMBL: CP001720.PE355

CP001720.PE355       Location/Qualifiers
FT   CDS_pept        385763..386758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0371"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="KEGG: avi:Avi_5352 ABC transporter nucleotide
FT                   binding/ATPase protein (oligopeptide); TIGRFAM:
FT                   oligopeptide/dipeptide ABC transporter, ATPase subunit;
FT                   PFAM: ABC transporter related; Oligopeptide/dipeptide ABC
FT                   transporter domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61320"
FT                   /db_xref="GOA:C8W4W8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C8W4W8"
FT                   /inference="protein motif:TFAM:TIGR01727"
FT                   /protein_id="ACV61320.1"
FT                   /translation="MLNNAVFQVNDLKTYFYTGSGVVKAVNGVSFQVQAGKTLCIVGES
FT                   GCGKSITLLSLLGLIEVPGKIISGEVYLNDRDILKLSSQELRKIRGKEISLIFQDPMTS
FT                   LNPVLKIGCQLTETILAHENCSKKEARDRSVSMLKKVGLPDPEKIMKRFSFQLSGGMRQ
FT                   RVMIAQALSLFPEVLIADEPTTALDVTVQAQILWELKKIQKEFNTALILVTHNLGVVAE
FT                   LADEVAVMYAGSIVEYGPVLNIFETPLHPYTQALLNSMPKFGYYHDLPVPIQGQPPNLL
FT                   NLPEQCAFAPRCSYVDNVCLGHKPGLTTINPGHKAACHKLKKPFKEGSVA"
     atgttaaaca atgctgtttt tcaagttaat gatttgaaaa catattttta taccggctca        60
     ggagtggtaa aggctgttaa cggggtcagt tttcaggttc aggcaggtaa aacactctgt       120
     attgttgggg aaagcggttg cggaaaaagc atcactttat tatctctgtt gggtttgatt       180
     gaagttccgg gaaagattat cagcggggaa gtctatttaa atgatcggga catattaaaa       240
     ctttcttcgc aagaactgcg taaaatcagg ggcaaagaga tttctttaat ttttcaggat       300
     cccatgactt cattgaaccc ggtgctaaaa ataggttgtc agcttactga aacaattctt       360
     gcccatgaga actgttctaa aaaggaagcc agagacagat cagtaagtat gcttaaaaag       420
     gttgggctgc ctgacccgga aaaaatcatg aaaagattct cttttcaact gagcggggga       480
     atgaggcaga gagttatgat tgcacaagca ctgtctttgt ttcctgaagt tttgattgcc       540
     gatgaaccca ccaccgcttt agatgtaacg gtacaggcgc aaatcttatg ggagcttaaa       600
     aaaatacaga aagaatttaa tacggctttg attcttgtaa cccataattt gggggttgta       660
     gcggaactgg ctgatgaagt ggcggtaatg tatgccggtt caattgtaga atacgggcct       720
     gtactgaata tatttgaaac cccgctgcat ccctatacac aagctttgct gaattcaatg       780
     cctaaatttg gttattatca tgatttgccg gtgccgattc agggacaacc gccaaatttg       840
     cttaatctgc cggaacaatg tgcctttgca ccgcgctgct cgtatgttga taatgtttgt       900
     ctgggtcata aacccggctt aacgacaatt aatccgggac acaaagcggc ttgtcataag       960
     ctgaaaaaac ctttcaagga aggttctgta gcatga                                 996
//

If you have problems or comments...

PBIL Back to PBIL home page