(data stored in ACNUC7421 zone)

EMBL: CP001720.PE356

CP001720.PE356       Location/Qualifiers
FT   CDS_pept        386755..387726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0372"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="KEGG: bja:blr1357 peptide ABC transporter ATP-
FT                   binding protein; TIGRFAM: oligopeptide/dipeptide ABC
FT                   transporter, ATPase subunit; PFAM: ABC transporter related;
FT                   Oligopeptide/dipeptide ABC transporter domain protein;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61321"
FT                   /db_xref="GOA:C8W4W9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C8W4W9"
FT                   /inference="protein motif:TFAM:TIGR01727"
FT                   /protein_id="ACV61321.1"
FT                   /translation="MILLKVANLKKKYNTSFGHFSAAKEIVYAVEDISFSLRQGETLAL
FT                   AGESGCGKSTLARLILRLEEPTGGKIIFAGEDITNLSGKKLRHIRKNMQIVFQDSSSSL
FT                   NQLQTVGASIEEPLNNFQIRTPKDRKQRVEELMEMVGIDRGYINKYPHQLSGGQRQRVS
FT                   LARALAITPRLLVLDEPVSSLDVSIQAQILNLLENLKKEYNLTYLFISHDLAVISQISD
FT                   RIAIMYLGSIIEIIRCEDLLAEAVHPYTTDLLASVPVPDPRQRKDRRKTLMGEPPNPLN
FT                   PPAGCRFHPRCRLAWQVCRQEKPTLRLIENEHMVACHLYGNR"
     atgattcttt tgaaagttgc taatttgaaa aagaaataca atacaagttt cggacatttt        60
     tccgcggcaa aggaaattgt gtatgctgta gaggatatat cgttttccct gcggcagggg       120
     gaaactctgg ctttagccgg ggagagcggg tgtgggaaaa gtaccctggc ccggttgatt       180
     ttgagactgg aggaaccgac cggggggaaa ataatatttg caggtgagga tattacaaat       240
     ctttcaggga aaaagctgcg gcatataaga aaaaatatgc agattgtttt ccaagattcc       300
     agttcatctc tgaatcagtt gcaaactgtt ggggcaagta ttgaagaacc tctgaataat       360
     ttccaaatca ggacccccaa agatcgtaaa caaagagtag aagagttaat ggaaatggta       420
     ggtattgatc gtgggtatat caacaagtac ccacatcaac taagcggcgg acaacgccag       480
     agagtcagcc tggccagggc cctggctatt acgccacggt tattggtgct tgatgaacct       540
     gtttccagtc tggatgtttc tattcaggct caaatattaa atttattaga aaacttaaaa       600
     aaagaatata atttgactta tttgtttatc tctcatgatt tggcagtgat cagtcaaatt       660
     agtgatcgga tagctataat gtatttgggc agtattatag agataatccg ttgtgaggat       720
     ttgttagcag aagccgttca tccctatacg acagatcttc tggcttctgt tcctgtgccg       780
     gacccccggc aaaggaaaga caggcggaaa actctaatgg gcgaacctcc aaatcctctt       840
     aacccgcccg ccggttgtcg ttttcatccc cggtgcaggt tggcctggca agtatgccgg       900
     caggagaaac ctaccttgcg gctaattgaa aatgaacaca tggttgcctg tcatttatac       960
     gggaacaggt ag                                                           972
//

If you have problems or comments...

PBIL Back to PBIL home page