(data stored in ACNUC7421 zone)

EMBL: CP001720.PE360

CP001720.PE360       Location/Qualifiers
FT   CDS_pept        392771..393328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0377"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma factor, sigma-70
FT                   family; PFAM: sigma-70 region 2 domain protein; Sigma-70
FT                   region 4 type 2; KEGG: pla:Plav_0951 ECF subfamily RNA
FT                   polymerase sigma-24 factor"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61325"
FT                   /db_xref="GOA:C8W4X3"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:C8W4X3"
FT                   /inference="protein motif:TFAM:TIGR02937"
FT                   /protein_id="ACV61325.1"
FT                   /translation="MDIPEEIIERVYLKDERAYEELFRLSWDQAVRICWLILRHQQDAE
FT                   EVAQDAFLKLYVHRQHLQDVRAFRSWFYRILVNTALDKVRKRKAVINIDEIHLSSPSND
FT                   ILQAERRMLIDGAMRHLSYGERTAVVLVHFIGCTEAEAAEAAGWKLGKLKYRLNRARRV
FT                   LAQEINEEVKDMVNTKGGVQYV"
     gtggatatac cggaggaaat tattgaacgt gtatacctta aagatgagcg agcgtacgag        60
     gaattattcc ggcttagctg ggatcaagct gttcgaatct gctggctgat tctaaggcac       120
     caacaagatg ctgaggaggt cgctcaagat gcgtttctta aactctatgt acaccgacaa       180
     cacctacaag atgtgcgtgc attccgtagt tggttctacc gaattttagt aaacacagca       240
     ttggacaaag tgcgcaagcg gaaggctgtt ataaacattg acgaaattca cctttctagc       300
     ccaagtaacg atatcctgca ggctgaacgc cgcatgctca tcgacggggc tatgagacat       360
     ctatcatatg gtgagagaac cgccgtcgtc ctcgtacatt tcattggttg cacggaggcc       420
     gaggctgccg aggccgccgg atggaaactg ggcaagctca aatatcgcct gaatcgtgca       480
     cgacgtgttc tcgctcagga gattaatgag gaagtaaaag atatggttaa caccaaagga       540
     ggcgttcagt atgtctga                                                     558
//

If you have problems or comments...

PBIL Back to PBIL home page