(data stored in ACNUC7421 zone)

EMBL: CP001720.PE361

CP001720.PE361       Location/Qualifiers
FT   CDS_pept        393321..394364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0378"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61326"
FT                   /db_xref="GOA:C8W4X4"
FT                   /db_xref="InterPro:IPR025436"
FT                   /db_xref="UniProtKB/TrEMBL:C8W4X4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61326.1"
FT                   /translation="MSDIFHKALMEDAARINVSKMTWAQVKRGHSRAHGKADWKRWLPV
FT                   YAVSAAILVIVAIGVSGFVSPVMAKALQKIPIIGELYSFTYISKLNQYASDANPSATDQ
FT                   GITVSAPKAYYDGKQVKLIYAIQVPEGYEPIDVTQINLTVTKILLNGKPLPIDSAEGGD
FT                   SLVSPNMYRGDVGWYLSSDQVSRSGMLTIPIRQVGTIKGNWTLYVPVSSVAIDNAIETV
FT                   FPKDASSTYEGITITVNKVSKGPVYTTISMQVRQPLQMNSRLPFYMPLNGMVLIVLTPS
FT                   RQDLAGEYIGALQPSKKFGNEEVWDDVTMQCITPSDDVKSIIVEPVLLGLERSQNIPQL
FT                   DVIVPLN"
     atgtctgaca tatttcacaa ggcattaatg gaagatgctg cacgcattaa cgtatccaaa        60
     atgacatggg cacaagtaaa acgaggccat agtcgcgcac acggaaaggc tgactggaaa       120
     cgttggctgc ccgtctacgc agtcagtgcc gcaatattag taatcgtggc gattggcgtt       180
     tcaggattcg tttcacctgt aatggccaag gcattgcaaa aaataccaat cattggtgag       240
     ttatactcgt ttacttatat ttcgaaactc aaccagtatg cgtcggatgc aaatccgtcg       300
     gcaactgacc agggaattac cgtgtctgcg ccaaaagcct attatgatgg caagcaggtg       360
     aaattaatct atgctattca ggtaccggaa gggtacgaac cgattgatgt tacacaaatt       420
     aaccttactg tgacaaagat tctattgaac ggtaaaccgc ttcctattga tagtgccgag       480
     gggggggatt ctttggtatc accaaatatg tatcgtggtg atgttggttg gtacctgtca       540
     tctgatcagg tgtcgcgaag cggcatgctg acgattccta ttcgtcaggt gggtacaata       600
     aaaggaaatt ggacactata tgttccagtt tctagtgtag cgatagataa tgccattgaa       660
     acagtgtttc caaaggatgc aagcagtacc tatgagggaa tcacaatcac tgtcaacaag       720
     gtatctaaag gaccggtata cacaactatc tcaatgcaag tacgccagcc actacagatg       780
     aatagcagac ttccgtttta tatgccttta aacggcatgg ttctgatcgt tttaacacca       840
     agccgccagg atcttgccgg agagtacatt ggcgcgctac aaccttccaa aaaatttgga       900
     aatgaagaag tttgggacga cgtaacaatg caatgtatta ccccgtcaga tgatgtaaag       960
     tccattattg ttgaacctgt tttgcttggc ttagaaagat ctcaaaatat accacaactt      1020
     gacgttattg ttccacttaa ttga                                             1044
//

If you have problems or comments...

PBIL Back to PBIL home page