(data stored in ACNUC7421 zone)

EMBL: CP001720.PE363

CP001720.PE363       Location/Qualifiers
FT   CDS_pept        complement(397470..399284)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0383"
FT                   /product="transposase IS4 family protein"
FT                   /note="PFAM: transposase IS4 family protein; KEGG:
FT                   shn:Shewana3_3655 IS4 family transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61328"
FT                   /db_xref="GOA:C8W4X6"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025457"
FT                   /db_xref="UniProtKB/TrEMBL:C8W4X6"
FT                   /inference="protein motif:PFAM:PF01609"
FT                   /protein_id="ACV61328.1"
FT                   /translation="MDLQPILEQLAKLPPEALMKIMPELKVEVPKANPSGAVLIGVFLA
FT                   RSLGIGKIIDDFIDEEYVTYEHLREERSNGSNCRVSTGLACEIMIGDMLGRNKDLTRLY
FT                   KFEEACENWQVETILGIPAKKFNDDKMGRALDTLNSNAKYMANVLQDVVLSASKRFDIP
FT                   LNTFYNDTSSVPVYGDMENNDKVQYGYGGMPGLKQLILNLTISAGASLPVTSTIDPGNV
FT                   QGGNTFERSFEKVKEITDGQEFEMIIDRGILTQDNMHLMLTNSNKKALFIGPLKDELSK
FT                   NWVLEQLDNTEKDDFVSIEYRSKKEIERNLTKHYVAFETEYTFKVEIDPLSKDKKDKKR
FT                   RKKGERKFVIHTIRAIIYCDLNKKPKEEERRQKRITSTEDALVELNSKLNKRNLITKEA
FT                   CEKAVDNIFKGQPEMRRLFNVEIGLNQHDALVMSWSKDEAIIPELEKTDGIFVLLTNHD
FT                   KEKVDANELLTRYRSRNDIEISFRFLKGSLDLQQVFLRNPERVDAYCFLKVLAMLVINL
FT                   AAWLLARNYKKMSTQKLQKELGDLTISEQRLQPIGVRHWNGTNIPNSIDVLVNLFNLPH
FT                   PLELIEIINSSINFSYYIEKWFNDNLKK"
     atggacttac aacctatttt agaacaactg gccaaattac cgcctgaagc gttgatgaag        60
     ataatgcccg aattaaaagt agaagttccg aaggcaaatc cctcaggtgc agtactcatc       120
     ggtgtttttt tagctagaag ccttggcatc ggtaaaataa ttgacgattt tattgatgaa       180
     gaatatgtta cttatgaaca tttacgtgaa gaaagatcca atggttctaa ttgtcgggta       240
     agcactggtc tagcatgtga aataatgata ggcgatatgc ttggcagaaa taaagacctt       300
     acccgtttat ataaatttga agaagcttgt gaaaattggc aagttgaaac aatactcggt       360
     ataccggcca aaaaatttaa tgatgacaaa atgggcagag cccttgatac tttaaactca       420
     aatgcaaaat atatggctaa tgtattgcaa gatgttgttt tatcggcatc caagagattt       480
     gatattccac ttaacacttt ttacaacgat acatcttccg ttccggtcta tggtgatatg       540
     gaaaataacg ataaggttca atatggatac gggggcatgc cgggtttaaa acaattaatc       600
     ctcaatctta ctatatccgc tggtgcatct ttgccggtaa catccacaat tgaccccggt       660
     aatgttcaag gtggcaatac ttttgagcgt tcatttgaga aggtcaagga aattaccgac       720
     ggccaagaat ttgagatgat tattgatcgt ggtattctga cccaagataa catgcatttg       780
     atgctcacca atagcaacaa aaaggcgtta tttattggcc cacttaagga cgaactatcg       840
     aaaaattggg ttttagagca attagataac actgagaaag atgattttgt ttctattgaa       900
     tatcgctcaa aaaaagaaat agaaagaaat ctaaccaaac actacgtggc atttgagaca       960
     gaatatacat ttaaagtaga aatcgatcct ctctcaaaag ataaaaagga taaaaagcgt      1020
     cgtaaaaaag gtgagcgaaa atttgtaatc catactatta gggcaattat ttattgtgat      1080
     ttgaataaaa aacctaagga agaagaacgt cgtcaaaaac gtataaccag cactgaagat      1140
     gccttagtag aactcaatag caagctcaac aaacgcaact taattaccaa ggaagcctgt      1200
     gaaaaggcgg tagataatat tttcaaaggg caacctgaaa tgcgtaggct gttcaatgta      1260
     gaaattgggc taaatcagca cgatgctctt gttatgtcct ggtcaaaaga tgaagcaata      1320
     attcctgaac tagagaaaac tgacggtatt tttgtgcttt taaccaacca cgataaagag      1380
     aaagttgatg ctaacgaact tctcacccgc taccggagta ggaacgatat tgaaatcagt      1440
     tttagatttt tgaagggttc ccttgattta caacaggttt tccttcgtaa tccggaaagg      1500
     gttgatgcct attgcttttt aaaagtattg gctatgctcg tgattaattt agccgcctgg      1560
     ttattggcta gaaattacaa aaaaatgtct acccaaaaat tacagaaaga acttggtgac      1620
     ctaactatat cagagcaaag gttgcaacct attggtgtac gtcattggaa tgggacgaat      1680
     attcctaata gcattgatgt attggttaat ctgtttaatt taccccatcc acttgagtta      1740
     atagagatca ttaattcgtc aataaatttt tcgtattata ttgagaaatg gtttaatgat      1800
     aatttaaaaa aataa                                                       1815
//

If you have problems or comments...

PBIL Back to PBIL home page