(data stored in ACNUC7421 zone)

EMBL: CP001720.PE364

CP001720.PE364       Location/Qualifiers
FT   CDS_pept        400126..400602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0384"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61329"
FT                   /db_xref="GOA:C8W4X7"
FT                   /db_xref="UniProtKB/TrEMBL:C8W4X7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61329.1"
FT                   /translation="MDKMPLISIIFYSLPEAYLIFSFGLIALGQKINVIRVILATVFFV
FT                   LSSYIIRMLPFPFGMHTAIGIAIIFLFFMIILRLKAKHALIATLISSGTLIALENSILY
FT                   LFQIELNLTPKQIWQDPLMRTLIGWPHLLVWSLITLIIYKRKIHIVRCRGNLEL"
     atggataaaa tgccgttaat tagcataata ttttactcat tgccggaagc ctacctcatt        60
     ttttctttcg gattgatagc tttggggcaa aaaattaacg taataagagt tatattggca       120
     accgtttttt ttgttttgtc ctcatacatt ataaggatgt tgcctttccc atttggaatg       180
     catactgcta ttggtatagc aattattttt ctgttcttta tgattatttt aaggttaaaa       240
     gcaaaacatg ccctgatagc gacgttgata agttctggta cattaatagc cttggagaat       300
     tcaattttat atctattcca gattgagtta aaccttaccc ccaaacaaat ctggcaagac       360
     cctttgatga gaaccttaat tggttggccg catttattag tttggtcttt aataactcta       420
     attatatata aaagaaagat acatatagtc cgttgtagag ggaatttgga gttgtga          477
//

If you have problems or comments...

PBIL Back to PBIL home page