(data stored in ACNUC7421 zone)

EMBL: CP001720.PE365

CP001720.PE365       Location/Qualifiers
FT   CDS_pept        400605..401447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0385"
FT                   /product="signal transduction histidine kinase regulating
FT                   citrate/malate metabolism"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   SMART: ATP-binding region ATPase domain protein; KEGG:
FT                   bha:BH0397 sensory histidine kinase DcuS"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61330"
FT                   /db_xref="GOA:C8W4X8"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR032834"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR039506"
FT                   /db_xref="UniProtKB/TrEMBL:C8W4X8"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ACV61330.1"
FT                   /translation="MQMTAKKTMEQLAVLLLIETCLALLAARVINFYENQMTASDVLIS
FT                   IMAVLNFGICLFIAKWIYKVEIIHEKVSTQNECLKSTEEALKIMRSERHDFINHLQTIY
FT                   GLIVTGEHNEAVGYIKDIGVDCKFNSQILNIQNPYIRILLQNKKNLTSAKNITFKLKVE
FT                   SNLMYLNIIPTAVTTVFGNLLDNAIDAVMECGTEYRKIISFEISETNTGYHFLIQNTGP
FT                   PINEEIEQDIFKEGFSTKGTGRGYGLVLVKKTVNEYDGRVFYDREAKGFSVILPKRED"
     atgcaaatga cagccaaaaa aaccatggaa caacttgcag tcttattatt aattgaaact        60
     tgtttagcct tattggcggc tagggtaata aacttctatg aaaatcaaat gaccgcatct       120
     gatgtgttaa tatcaataat ggctgtatta aacttcggga tatgtctttt catagctaaa       180
     tggatctaca aagtggaaat tatacatgag aaagtaagta cacagaatga atgtctaaaa       240
     tcaacggaag aagcattaaa gataatgcgt agtgaacgac atgactttat taatcatcta       300
     cagaccattt atggattgat tgttaccggt gaacacaatg aggccgttgg ttacattaag       360
     gatatcggcg ttgattgtaa attcaacagc caaattttga atatccaaaa cccatacatt       420
     aggatactcc tgcaaaataa gaaaaacctc acaagtgcta aaaacattac ctttaagtta       480
     aaagttgaga gtaatttaat gtatctcaat atcatcccta ccgctgtaac aacagtattt       540
     ggaaatcttt tagacaatgc catagatgcg gtaatggagt gtggcacaga gtaccgaaaa       600
     ataataagct ttgaaataag tgaaacgaat accggctatc atttcttaat acaaaatacc       660
     ggtccgccaa ttaacgaaga aattgaacag gatatattta aagaggggtt ttctacgaaa       720
     ggtaccggga gaggttacgg tctggtgctg gttaagaaaa cagttaatga atacgacggc       780
     agggtatttt acgaccggga agcaaaaggt ttttccgtta ttcttcctaa gcgggaggat       840
     taa                                                                     843
//

If you have problems or comments...

PBIL Back to PBIL home page