(data stored in ACNUC7421 zone)

EMBL: CP001720.PE368

CP001720.PE368       Location/Qualifiers
FT   CDS_pept        402266..402967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0388"
FT                   /product="two component transcriptional regulator, LytTR
FT                   family"
FT                   /note="PFAM: LytTr DNA-binding region; response regulator
FT                   receiver; SMART: response regulator receiver; KEGG:
FT                   gme:Gmet_2697 LytR/AlgR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61333"
FT                   /db_xref="GOA:C8W4Y1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR007492"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:C8W4Y1"
FT                   /inference="protein motif:PFAM:PF04397"
FT                   /protein_id="ACV61333.1"
FT                   /translation="MRVIIAEDNPVEMRYLKNLLSRESDIEIIGEVSDGWEATKMISKL
FT                   QPEVAFLDISMPGISGMDLVRKFDGRVIIVLVTAHHEYALDAFEAGSMDYLLKPVEPER
FT                   VSLTIRRLRKILSRKTRYSGRININTKDSIIAVEIDSIIFIEKVPLAKKIKIQTVNNEY
FT                   IVSGTLNEFEDKLKSLGFIRTHKSFIINPDKLEKMIPWGDKSYLAKMHGVKKEALVSRK
FT                   YAGMVKSAIKW"
     atgagagtaa ttattgccga agacaatccg gtagagatga gatatttaaa gaatctgtta        60
     agccgggaaa gtgacataga aataatcgga gaggtttcag atggttggga agccacgaaa       120
     atgatatcaa aactgcaacc tgaagtagcc tttctggata tatctatgcc gggaatttca       180
     gggatggact tagtgaggaa atttgacggt agagttatta ttgtcttagt aacagctcat       240
     catgaatatg cactggatgc tttcgaagcc ggttccatgg attacctgct aaaaccagtt       300
     gagccggaaa gagtaagcct tactataagg cgacttagga aaatattatc tcgcaaaaca       360
     agatattcgg gaagaataaa tatcaatact aaggactcaa taattgccgt tgagatagac       420
     agtattattt ttattgaaaa ggttccactt gcaaaaaaga taaaaattca aacagtaaat       480
     aatgaataca tcgtgtccgg aacattaaac gagtttgaag ataaactgaa aagcctaggt       540
     tttatcagaa ctcataaaag ttttattata aacccagata aattagagaa aatgattccc       600
     tggggtgata aatcatatct ggccaaaatg catggtgtaa agaaggaagc tcttgttagc       660
     cgaaaatatg cggggatggt taagtcagca attaaatggt ag                          702
//

If you have problems or comments...

PBIL Back to PBIL home page