(data stored in ACNUC7421 zone)

EMBL: CP001720.PE37

CP001720.PE37        Location/Qualifiers
FT   CDS_pept        complement(38838..39107)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0038"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="PFAM: regulatory protein ArsR; SMART: regulatory
FT                   protein ArsR; KEGG: bsu:BSU33790 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61002"
FT                   /db_xref="GOA:C8VVD1"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C8VVD1"
FT                   /inference="protein motif:PFAM:PF01022"
FT                   /protein_id="ACV61002.1"
FT                   /translation="MISSTFKALADPTRRKILKLLKEQDMRAGEIADNFNISKPSISHH
FT                   LNILKQARLVLDERKGQFIYYSLNMTVFQEILGWFSGIIDRKDW"
     ttgattagct caaccttcaa agcactggct gatccgacaa gacgaaaaat tttgaagctc        60
     ctcaaggaac aggatatgag agcaggagaa atagcagata attttaatat tagtaaaccc       120
     agcatttcac atcatttaaa cattttgaaa caggccaggc tggtattgga tgagcgtaag       180
     gggcaattca tttattattc gctgaacatg actgtttttc aagaaattct gggatggttt       240
     tccgggatta ttgatagaaa ggattggtga                                        270
//

If you have problems or comments...

PBIL Back to PBIL home page