(data stored in ACNUC7421 zone)

EMBL: CP001720.PE373

CP001720.PE373       Location/Qualifiers
FT   CDS_pept        complement(407618..408088)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0394"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: xau:Xaut_0512 preprotein translocase, SecA
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61338"
FT                   /db_xref="UniProtKB/TrEMBL:C8W4Y6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61338.1"
FT                   /translation="MLKRLKLRFTFVLVLALVLGIVSSATVYASNNDSKNSIVKKTEKR
FT                   LEAANNDIKSTLKLDNILNDYKQIDFPNGIDFNKDLDIAQEFDALDQSPIGSTMPIFLL
FT                   KNDLSEIMVLYKEGDGTNVMKYAKRVNGNKWAEGEKRIKGAPILDINTIKDE"
     atgttaaaaa gacttaaatt gcgttttacg ttcgtattag ttctagcttt agtactagga        60
     attgtatcta gtgctactgt ttatgcatcc aataatgaca gtaagaatag tattgtcaaa       120
     aaaacagaaa aaagactaga agctgctaat aacgatatta aaagcacttt aaaactggat       180
     aatattttaa atgactataa acagatcgat ttccctaatg gaattgactt caataaagac       240
     ttagatattg cacaagaatt tgatgcttta gatcagtctc caattggttc tactatgcca       300
     atatttttat taaaaaatga tttatcagag attatggttt tatataaaga aggagatgga       360
     acaaatgtta tgaagtatgc aaaaagagtg aatggtaata aatgggcgga gggagaaaaa       420
     agaataaaag gtgctccgat tttagacatt aatacaataa aagatgaata a                471
//

If you have problems or comments...

PBIL Back to PBIL home page